ERG6/YML008C Single Page Format

Help

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

SGD Locus Page

Names and Identifiers [TOP] [NEXT] Help
Standard Name Systematic Name Alias Feature Type SGDID
ERG6 YML008C ISE1, LIS1, SED6, VID1 ORF, Verified S000004467
Description
Delta(24)-sterol C-methyltransferase, converts zymosterol to fecosterol in the ergosterol biosynthetic pathway by methylating position C-24; localized to both lipid particles and mitochondrial outer membrane

GO Annotations [TOP] [NEXT] Help
Molecular Function
Annotation(s)Reference(s)EvidenceAssigned By
methyltransferase activityDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR013216 , EBI:IPR013705
Assigned on 2007-05-23
UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0489
Assigned on 2007-05-23
UniProtKB
sterol 24-C-methyltransferase activityGOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with IUBMB:2.1.1.41
Assigned on 2007-05-23
UniProtKB
Jayasimha P and Nes WD (2008) Photoaffinity Labeling and Mutational Analysis of 24-C-Sterol Methyltransferase Defines the AdoMet Binding Site. Lipids 43(8):681-93
SGD Papers Entry  Pubmed Entry  
IDA : Inferred from Direct Assay
Assigned on 2008-07-18
SGD
transferase activityGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23
UniProtKB
Biological Process
Annotation(s)Reference(s)EvidenceAssigned By
alcohol metabolic processHuttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
SGD Papers Entry  
RCA : Reviewed Computational Analysis
Assigned on 2009-08-06
bioPIXIE_MEFIT
cellular metabolic compound salvageHuttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
SGD Papers Entry  
RCA : Reviewed Computational Analysis
Assigned on 2009-08-06
bioPIXIE_MEFIT
ergosterol biosynthetic processPaltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
SGD Papers Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-19
SGD
lipid biosynthetic processGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0444
Assigned on 2007-05-23
UniProtKB
metabolic processDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR013216
Assigned on 2007-05-23
UniProtKB
steroid biosynthetic processDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR013705
Assigned on 2009-01-12
UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0752
Assigned on 2007-05-23
UniProtKB
sterol biosynthetic processGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0756
Assigned on 2007-05-23
UniProtKB
Cellular Component
Annotation(s)Reference(s)EvidenceAssigned By
endoplasmic reticulumPaltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
SGD Papers Entry  
TAS : Traceable Author Statement
Assigned on 2001-01-19
SGD
lipid particleAthenstaedt K, et al. (1999) Identification and characterization of major lipid particle proteins of the yeast Saccharomyces cerevisiae. J Bacteriol 181(20):6441-8
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IDA : Inferred from Direct Assay
Assigned on 2001-01-18
SGD
mitochondrial outer membraneZahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
IDA : Inferred from Direct Assay
Assigned on 2006-03-17
SGD
mitochondrionSickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
SGD Papers Entry  Pubmed Entry  Web Supplement  yfgdb  
IDA : Inferred from Direct Assay
Assigned on 2004-09-28
SGD
Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  yfgdb  
IDA : Inferred from Direct Assay
Assigned on 2006-12-12
SGD

Pathways [TOP] [NEXT] Help
ergosterol biosynthesis

Summary Paragraph [TOP] [NEXT] Help
SUMMARY PARAGRAPH for ERG6/YML008C for ERG6
ERG6 encodes delta(24)-sterol C-methyltransferase, which converts zymosterol to fecosterol by methylating C-24 in the ergosterol biosynthetic pathway (1, 2, 3, 4). Cells lacking ERG6 are viable but unable to methylate sterols on C-24, and exhibit pleiotropic growth phenotypes (1). erg6 mutants show increased cation uptake (5), and are permeable and therefore sensitive to brefeldin A, a drug that disrupts secretion (6, 7). Enzymes similar to Erg6p have been identified in other organisms; a homolog from Candida albicans complements the S. cerevisiae erg6 null phenotype, and a homologous enzyme from Arabidopsis is active in yeast (8, 9).

Last Updated: 2000-09-05

Basic References [TOP]   Help
BASIC INFORMATION REFERENCES forERG6/YML008C for ERG6
1)Gaber RF, et al. (1989) The yeast gene ERG6 is required for normal membrane function but is not essential for biosynthesis of the cell-cycle-sparking sterol. Mol Cell Biol 9(8):3447-56
SGD Papers Entry  Pubmed Entry  
2)Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
SGD Papers Entry  
3)Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6
SGD Papers Entry  Pubmed Entry  
4)Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30
SGD Papers Entry  Pubmed Entry  
5)Welihinda AA, et al. (1994) Mutations in LIS1 (ERG6) gene confer increased sodium and lithium uptake in Saccharomyces cerevisiae. Biochim Biophys Acta 1193(1):107-17
SGD Papers Entry  Pubmed Entry  
6)Graham TR, et al. (1993) Brefeldin A reversibly blocks early but not late protein transport steps in the yeast secretory pathway. EMBO J 12(3):869-77
SGD Papers Entry  Pubmed Entry  
7)Shah N and Klausner RD (1993) Brefeldin A reversibly inhibits secretion in Saccharomyces cerevisiae. J Biol Chem 268(8):5345-8
SGD Papers Entry  Pubmed Entry  
8)Jensen-Pergakes KL, et al. (1998) Sequencing, disruption, and characterization of the Candida albicans sterol methyltransferase (ERG6) gene: drug susceptibility studies in erg6 mutants. Antimicrob Agents Chemother 42(5):1160-7
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
9)Husselstein T, et al. (1996) Transformation of Saccharomyces cerevisiae with a cDNA encoding a sterol C-methyltransferase from Arabidopsis thaliana results in the synthesis of 24-ethyl sterols. FEBS Lett 381(1-2):87-92
SGD Papers Entry  Pubmed Entry  
10)Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  

Mutant Phenotypes [TOP] [NEXT] Help
Phenotype page for ERG6/YML008C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT] Help
Interaction page for ERG6/YML008C

Homologs [TOP] [NEXT] Help
  • Comparison Resources
  • Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT] Help
    Protein Sequence Calculations
    from Predicted Full length Translation
    N-term MSETELR
    C-term TSQEATQ
    Length(aa) 383
    MW(Da) 43,431
    pI 5.6
    Amino Acid Composition (full length)
    GCG tools: PepPlot, Helical Wheel, PepStruct

    Transcript Translation Calculations
    Codon Bias 0.340  
    Codon Adaptation Index 0.308  
    Frequency of Optimal Codons 0.608  
    Hydropathicity of Protein -0.550  
    Aromaticity Score 0.123  

                              10        20        30        40        50
                               |         |         |         |         |
                      MSETELRKRQAQFTRELHGDDIGKKTGLSALMSKNNSAQKEAVQKYLRNW
                      DGRTDKDAEERRLEDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGESF
                      AASIARHEHYLAYKAGIQRGDLVLDVGCGVGGPAREIARFTGCNVIGLNN
                      NDYQIAKAKYYAKKYNLSDQMDFVKGDFMKMDFEENTFDKVYAIEATCHA
                      PKLEGVYSEIYKVLKPGGTFAVYEWVMTDKYDENNPEHRKIAYEIELGDG
                      IPKMFHVDVARKALKNCGFEVLVSEDLADNDDEIPWYYPLTGEWKYVQNL
                      ANLATFFRTSYLGRQFTTAMVTVMEKLGLAPEGSKEVTAALENAAVGLVA
                      GGKSKLFTPMMLFVARKPENAETPSQTSQEATQ*
    

    Protein Structures from PDB: proteins of known structure with sequence similarity to ERG6/YML008C, based on Smith-Waterman analysis. [TOP] [NEXT] Help
    PDB protein structure(s) homologous to ERG6Homolog Source (per PDB)Protein Alignment: ERG6 vs. HomologExternal Links
    P-Value%Identical%SimilarAlignment
    3bus ( Chain: B, A)
    Crystal structure of rebm
  • PDB_Info
  • PDB_Structure
  • Lechevalieria aerocolonigenesChain B = 1.8e-122631View alignmentSCOP
    MMDB
    CATH
    Chain A = 1.8e-122631View alignment
    2o57 ( Chain: C, A, B, D)
    Crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria
  • PDB_Info
  • PDB_Structure
  • Galdieria sulphurariaChain C = 6.0e-102730View alignmentSCOP
    MMDB
    CATH
    Chain A = 6.0e-102730View alignment
    Chain B = 6.0e-102730View alignment
    Chain D = 6.0e-102730View alignment
    1ve3 ( Chain: A, B)
    Crystal structure of ph0226 protein from pyrococcus horikoshii ot3
  • PDB_Info
  • PDB_Structure
  • Pyrococcus horikoshiiChain A = 3.1e-083830View alignmentSCOP
    MMDB
    CATH
    Chain B = 3.1e-083830View alignment
    1wzn ( Chain: C, A, B)
    Crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3
  • PDB_Info
  • PDB_Structure
  • Pyrococcus horikoshii OT3Chain C = 4.8e-053533View alignmentSCOP
    MMDB
    CATH
    Chain A = 4.8e-053533View alignment
    Chain B = 4.8e-053533View alignment
    2p8j ( Chain: A, B)
    Crystal structure of s-adenosylmethionine-dependent methyltransferase (np_349143.1) from clostridium acetobutylicum at 2.00 a resolution
  • PDB_Info
  • PDB_Structure
  • Clostridium acetobutylicumChain A = 0.0001492932View alignmentSCOP
    MMDB
    CATH
    Chain B = 0.0001492932View alignment
    3e7p ( Chain: A)
    Crystal structure of of putative methyltransferase from bacteroides vulgatus atcc 8482
  • PDB_Info
  • PDB_Structure
  • Bacteroides vulgatus ATCC 84820.0011002731View alignmentSCOP
    MMDB
    CATH
    3gdh ( Chain: C, A, B)
    Trimethylguanosine synt
  • PDB_Info
  • PDB_Structure
  • UnknownChain C = 0.0020993038View alignmentSCOP
    MMDB
    CATH
    Chain A = 0.0020993038View alignment
    Chain B = 0.0020993038View alignment
    3egi ( Chain: B, A, C, D)
    Methyltransferase domain of human trimethylguanosine synthase tgs1 bound to m7gpppa (inactive form)
  • PDB_Info
  • PDB_Structure
  • Homo sapiensChain B = 0.0050973235View alignmentSCOP
    MMDB
    CATH
    Chain A = 0.0050973235View alignment
    Chain C = 0.0050973235View alignment
    Chain D = 0.0050973235View alignment

    Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT] Help
  • Functional Analysis
  • You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

    Locus History (misc. notes) [TOP] [NEXT] Help
    Nomenclature History
    Standard NameReference
    ERG6SGD (2007) Information without a citation in SGD
    SGD Papers Entry  
    Alias Name(s)Reference
    VID1Shieh HL, et al. (2001) Biochemical analysis of fructose-1,6-bisphosphatase import into vacuole import and degradation vesicles reveals a role for UBC1 in vesicle biogenesis. J Biol Chem 276(13):10398-406
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    Mapping Notes
    DateNote
    1989-10-01Edition 10: erg6 was mapped near trp1 on the 1985 map, and this assignment has been shown to be incorrect. It has recently been remapped on chromosome XIIIR

    Mortimer RK, et al. (1989) Genetic map of Saccharomyces cerevisiae, edition 10. Yeast 5(5):321-403
    SGD Papers Entry  Pubmed Entry  SGD Curated Comments & Errata

    Sequence Retrieval [TOP] [NEXT] Help
    Sequence Type Output Format
    Genomic DNA GCG | FASTA | NoHeader
    Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader
    DNA coding sequence
    (without introns, without flanking regions)
    GCG | FASTA | NoHeader
    Protein Translation of ORF GCG | FASTA | NoHeader
    6-Frame Translation(with Restriction Map) GCG
    Restriction Fragment Sizes GCG
  • Sequence Analysis Tools
  • Sequence from other databases
    Sequence IDSource
    YML008CSGD Systematic Sequence
    855003NCBI: Gene ID
    NP_013706.1NCBI: RefSeq protein version ID
    NP_013706.1NCBI: RefSeq protein version ID
    6323635NCBI: NCBI protein GI

    Map and Displays [TOP] [NEXT] Help
    Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
    Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map  

    Localization [TOP] [NEXT] Help
  • Localization Resources
  • Community Annotation [TOP] [NEXT] Help
    No community annotation available.

    Literature Guide: papers categorized by topic. [TOP]   Help
    TopicsReferenceOther Genes Addressed
    171 curated references; 0 references not yet curated
    Genetic Interactions
    Mutants/Phenotypes
    Hodg CA, et al. (2010) Integral membrane proteins Brr6 and Apq12 link assembly of the nuclear pore complex to lipid homeostasis in the endoplasmic reticulum. J Cell Sci 123(Pt 1):141-151
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACC1 |APQ12 |ARE1 |ARE2 |ARV1 |BRR6 |DGA1 |ELO1 |ERG2 |ERG3 |ERG4 |ERG5 |FEN1 |LRO1 |MORE
    Regulation of
    Zeng T and Li J (2010) Maximization of negative correlations in time-course gene expression data for enhancing understanding of molecular pathways. Nucleic Acids Res 38(1):e1
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACO2 |ADR1 |CAB2 |CAT8 |CIT1 |ERG2 |ERG26 |ERG27 |ERG4 |ERG5 |GCN4 |GTT1 |HAP1 |HAP3 |MORE
    Mutants/Phenotypes
    Strains/Constructs
    Abe F and Hiraki T (2009) Mechanistic role of ergosterol in membrane rigidity and cycloheximide resistance in Saccharomyces cerevisiae. Biochim Biophys Acta 1788(3):743-52
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG2 |ERG3 |ERG4 |ERG5 |PDR5 |UPC2
    Mutants/Phenotypes
    Strains/Constructs
    Banuelos MG, et al. (2009) Genomic analysis of severe hypersensitivity to hygromycin B reveals linkage to vacuolar defects and new vacuolar gene functions in Saccharomyces cerevisiae. Curr Genet
    SGD Papers Entry  Pubmed Entry  
    |ARF1 |BUD32 |BUR2 |CHC1 |CIN5 |CPA1 |DBP7 |DHH1 |DRS2 |GET2 |GLN3 |HHY1 |ISM1 |MCT1 |MORE
    Regulation of
    Bruckmann A, et al. (2009) Proteome analysis of aerobically and anaerobically grown Saccharomyces cerevisiae cells. J Proteomics 71(6):662-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACH1 |ACS1 |ACS2 |ADE17 |ADH1 |ADH2 |ALD4 |ALD6 |APE2 |ARP3 |ASC1 |ASN1 |ATP1 |ATP2 |MORE
    Other Features
    Connerth M, et al. (2009) Analysis of lipid particles from yeast. Methods Mol Biol 579:359-74
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AYR1 |ERG1 |ERG7 |POR1 |PRC1 |SEC61 |WBP1
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Daicho K, et al. (2009) Sorting defects of the tryptophan permease Tat2 in an erg2 yeast mutant. FEMS Microbiol Lett 298(2):218-27
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG2 |ERG3 |ERG4 |ERG5 |TAT2 |TRP1
    Reviews
    Ding J, et al. (2009) Tolerance and stress response to ethanol in the yeast Saccharomyces cerevisiae. Appl Microbiol Biotechnol 85(2):253-63
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ADA2 |ASR1 |ATP1 |BEM2 |CHD1 |CTT1 |DDR2 |ERO1 |FEN1 |GCN5 |GIM4 |GIM5 |HFI1 |HMI1 |MORE
    Reviews
    Goodman JM (2009) Demonstrated and inferred metabolism associated with cytosolic lipid droplets. J Lipid Res 50(11):2148-56
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AYR1 |DGA1 |EHT1 |ERG1 |ERG26 |ERG27 |ERG7 |FAA1 |FAA4 |FAT1 |SLC1 |TGL1 |TGL3 |TGL4 |MORE
    Mutants/Phenotypes
    Strains/Constructs
    Jones L, et al. (2009) Cdc42p is activated during vacuole membrane fusion in a sterol-dependent subreaction of priming. J Biol Chem
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC42 |ERG2 |ERG3 |ERG4 |ERG5 |RDI1 |SEC17 |SEC18 |STE20
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Muthusamy BP, et al. (2009) Control of protein and sterol trafficking by antagonistic activities of a type IV P-type ATPase and oxysterol binding protein homologue. Mol Biol Cell 20(12):2920-31
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CPS1 |DNF1 |DNF2 |DNF3 |DRS2 |GGA1 |GGA2 |KES1 |PHO8 |PRC1 |SAC1 |SNC1
    RNA Levels and Processing
    Pedroso N, et al. (2009) Modulation of plasma membrane lipid profile and microdomains by H(2)O(2) in Saccharomyces cerevisiae. Free Radic Biol Med 46(2):289-98
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACC1 |ELO1 |ERG1 |ERG25 |ERG3 |ERG7 |FAS1 |FEN1 |GPT2 |LAC1 |LIP1 |OLE1 |RAD27 |SUR4
    Reviews
    Petrossian T and Clarke S (2009) Bioinformatic identification of novel methyltransferases Epigenomics 1(1):163-175
    SGD Papers Entry  
    |ABD1 |ABP140 |AML1 |BIO2 |BUD23 |CHO2 |COQ3 |COQ5 |CRG1 |CTM1 |DIM1 |DOT1 |DPH5 |ELP3 |MORE
    Protein Sequence Features
    Petrossian TC and Clarke SG (2009) Multiple Motif Scanning to identify methyltransferases from the yeast proteome. Mol Cell Proteomics 8(7):1516-26
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |COQ3 |COQ5 |CRG1 |MAM3 |OMS1 |PPM2 |RSM22 |SEE1 |SPE3 |SPE4 |TMT1 |TRM12 |TRM9 |TYW3 |MORE
    Regulation of
    Transcription
    Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
    Function/Process
    Protein Processing/Modification/Regulation
    Rossignol T, et al. (2009) The proteome of a wine yeast strain during fermentation, correlation with the transcriptome. J Appl Microbiol 107(1):47-55
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACT1 |ADE5,7 |ADH1 |AHP1 |ARO9 |ASC1 |ASN1 |CDC48 |CYS3 |EFT1 |ENO1 |ENO2 |FBA1 |GDH1 |MORE
    Large-scale phenotype analysis
    Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAT2 |ADO1 |AIM26 |ALG7 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |CSG2 |ELP2 |ERG2 |MORE
    Mutants/Phenotypes
    Yoshikawa K, et al. (2009) Comprehensive phenotypic analysis for identification of genes affecting growth under ethanol stress in Saccharomyces cerevisiae. FEMS Yeast Res 9(1):32-44
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ALD6 |ARO1 |ARO2 |ARO7 |COQ10 |COQ5 |COQ9 |COX11 |COX12 |COX14 |COX16 |COX18 |COX23 |COX7 |MORE
    Cell Growth and Metabolism
    Function/Process
    Strains/Constructs
    Zhang Z, et al. (2009) [Regulation role of sterol C-24 methyltransferase and sterol C-8 isomerase in the ergosterol biosynthesis of Saccharomyces cerevisiae] Wei Sheng Wu Xue Bao 49(8):1063-8
    SGD Papers Entry  Pubmed Entry  
    |ERG2
    Mutants/Phenotypes
    Strains/Constructs
    de Graaf B, et al. (2009) Cellular pathways for DNA repair and damage tolerance of formaldehyde-induced DNA-protein crosslinks. DNA Repair (Amst) 8(10):1207-14
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ADH1 |ARP5 |BEM4 |CDC26 |CDC50 |CTF4 |DAL81 |ECM30 |ERG3 |ERG5 |LSM1 |MED1 |MGM101 |MMS22 |MORE
    Mutants/Phenotypes
    Folmer V, et al. (2008) H(2)O(2) induces rapid biophysical and permeability changes in the plasma membrane of Saccharomyces cerevisiae. Biochim Biophys Acta 1778(4):1141-7
    SGD Papers Entry  Pubmed Entry  
    |ERG3
    Function/Process
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Protein Sequence Features
    Strains/Constructs
    Ganapathy K, et al. (2008) Molecular probing of the Saccharomyces cerevisiae sterol 24-C methyltransferase reveals multiple amino acid residues involved with C(2)-transfer activity. Biochim Biophys Acta 1781(6-7):344-51
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Mutants/Phenotypes
    Strains/Constructs
    Grossmann G, et al. (2008) Plasma membrane microdomains regulate turnover of transport proteins in yeast. J Cell Biol 183(6):1075-88
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CAN1 |CAX4 |COG1 |ELP6 |ERG2 |ERG24 |ERG5 |FUR4 |FYV6 |GOS1 |HNT3 |MDG1 |MNN10 |MNN11 |MORE
    Fungal Related Genes/Proteins
    Iwaki T, et al. (2008) Multiple functions of ergosterol in the fission yeast Schizosaccharomyces pombe. Microbiology 154(Pt 3):830-41
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG2 |ERG3 |ERG4 |ERG5
    Function/Process
    Fungal Related Genes/Proteins
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Protein Physical Properties
    Protein Sequence Features
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Jayasimha P and Nes WD (2008) Photoaffinity Labeling and Mutational Analysis of 24-C-Sterol Methyltransferase Defines the AdoMet Binding Site. Lipids 43(8):681-93
    SGD Papers Entry  Pubmed Entry  

    Genetic Interactions
    Mutants/Phenotypes
    Jin H, et al. (2008) Ergosterol promotes pheromone signaling and plasma membrane fusion in mating yeast. J Cell Biol 180(4):813-26
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG2 |ERG3 |LCB1 |PRM1 |STE5
    Mutants/Phenotypes
    Protein-protein Interactions
    Strains/Constructs
    Khoury CM, et al. (2008) A TSC22-like motif defines a novel antiapoptotic protein family. FEMS Yeast Res 8(4):540-63
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACA1 |ARR1 |CAD1 |CIN5 |CST6 |FYV10 |GCN4 |HAC1 |KCS1 |MCA1 |MET28 |NKP1 |RTG1 |RTG3 |MORE
    Translational Regulation
    Melamed D, et al. (2008) Yeast translational response to high salinity: global analysis reveals regulation at multiple levels. RNA 14(7):1337-51
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ADK1 |AIM17 |ALD3 |AQR1 |ARG2 |ARG3 |ARG5,6 |ARG7 |ARG80 |ARG81 |ARG82 |AST1 |BCY1 |BTN2 |MORE
    Function/Process
    Mutants/Phenotypes
    Protein Physical Properties
    Protein Processing/Modification/Regulation
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Nes WD, et al. (2008) Yeast sterol C24-methyltransferase: role of highly conserved tyrosine-81 in catalytic competence studied by site-directed mutagenesis and thermodynamic analysis. Arch Biochem Biophys 477(2):313-23
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Mutants/Phenotypes
    Strains/Constructs
    Rojas M, et al. (2008) Genomewide expression profiling of cryptolepine-induced toxicity in Saccharomyces cerevisiae. Antimicrob Agents Chemother 52(11):3844-50
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AFT1 |ALD3 |ARN1 |ARN2 |CCP1 |CDC19 |CIS3 |CTT1 |DAN1 |ECM33 |EGT2 |ENO2 |ERV1 |EXG2 |MORE
    Mutants/Phenotypes
    Strains/Constructs
    Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
    Mutants/Phenotypes
    Strains/Constructs
    Serero A, et al. (2008) Yeast genes involved in cadmium tolerance: Identification of DNA replication as a target of cadmium toxicity. DNA Repair (Amst) 7(8):1262-75
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ADA2 |ARP5 |ATP1 |BRO1 |BUR2 |CCR4 |CCS1 |CTF4 |CTR1 |CUP2 |CYS4 |DID4 |DNA2 |DOA4 |MORE
    Mutants/Phenotypes
    Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ARV1 |ATG17 |ATP17 |BDF1 |BEM1 |MORE
    Cellular Location
    Other Features
    Strains/Constructs
    Takeda Y and Nakano A (2008) In vitro Formation of a Novel Type of Membrane Vesicles Containing Dpm1p: Putative Transport Vesicles for Lipid Droplets in Budding Yeast. J Biochem 143(6):803-11
    SGD Papers Entry  Pubmed Entry  
    |DPM1
    Mutants/Phenotypes
    Strains/Constructs
    Tang F, et al. (2008) A life-span extending form of autophagy employs the vacuole-vacuole fusion machinery. Autophagy 4(7):874-86
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ATG1 |ATG10 |ATG11 |ATG15 |ATG17 |ATG22 |ATG7 |ATG8 |AVT3 |AVT4 |ERG2 |ERG28 |ERG5 |GSG1 |MORE
    Mutants/Phenotypes
    Ulanovskaya OA, et al. (2008) Synthesis enables identification of the cellular target of leucascandrolide A and neopeltolide. Nat Chem Biol 4(7):418-24
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ATG11 |COB |COR1 |CYT1 |ERG3 |HOM3 |KCS1 |PPA1 |QCR10 |QCR2 |QCR6 |QCR7 |QCR8 |QCR9 |MORE
    Cellular Location
    Strains/Constructs
    Vorvis C, et al. (2008) Photoactivatable GFP tagging cassettes for protein-tracking studies in the budding yeast Saccharomyces cerevisiae. Yeast 25(9):651-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |NUM1
    Genetic Interactions
    Infection and Antifungals
    Mutants/Phenotypes
    Strains/Constructs
    Welscher YM, et al. (2008) Natamycin Blocks Fungal Growth by Binding Specifically to Ergosterol without Permeabilizing the Membrane. J Biol Chem 283(10):6393-401
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG2 |ERG3 |ERG4 |ERG5
    Cross-species Expression
    Disease Gene Related
    Mutants/Phenotypes
    Strains/Constructs
    Zabrocki P, et al. (2008) Phosphorylation, lipid raft interaction and traffic of alpha-synuclein in a yeast model for Parkinson. Biochim Biophys Acta 1783(10):1767-80
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CKA1 |CKA2 |CKB1 |CKB2 |DOA4 |ERG24 |ERG28 |MAK3 |MDM20 |NAT3 |PEP12 |PKH1 |PKH2 |RVS161 |MORE
    Mutants/Phenotypes
    Strains/Constructs
    Zhang M, et al. (2008) Deletion of yeast CWP genes enhances cell permeability to genotoxic agents. Toxicol Sci 103(1):68-76
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CWP1 |CWP2 |PDR5
    Mutants/Phenotypes
    Burgis NE and Samson LD (2007) The Protein Degradation Response of Saccharomyces cerevisiae to Classical DNA-Damaging Agents. Chem Res Toxicol 20(12):1843-53
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |MAG1 |MEC1 |PEP3 |RAD23 |RAD6 |RPN10 |RPN4 |UBI4 |VAM3 |YDJ1
    Mutants/Phenotypes
    Strains/Constructs
    Daicho K, et al. (2007) The ergosterol biosynthesis inhibitor zaragozic acid promotes vacuolar degradation of the tryptophan permease Tat2p in yeast. Biochim Biophys Acta 1768(7):1681-1690
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG1 |ERG11 |ERG9 |PEP12 |PEP4 |RSP5 |TAT2 |VPS1 |VPS27 |VPS45
    Mutants/Phenotypes
    Fairn GD, et al. (2007) A chemogenomic screen in Saccharomyces cerevisiae uncovers a primary role for the mitochondria in farnesol toxicity and its regulation by the Pkc1 pathway. J Biol Chem 282(7):4868-74
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |AIM21 |ARG4 |BCK1 |CBP1 |CLA4 |COR1 |COX11 |DAL5 |ECM33 |EOS1 |FSF1 |FUI1 |FUR4 |FYV6 |MORE
    Mutants/Phenotypes
    Strains/Constructs
    Ito-Harashima S, et al. (2007) Translation of the poly(A) tail plays crucial roles in nonstop mRNA surveillance via translation repression and protein destabilization by proteasome in yeast. Genes Dev 21(5):519-24
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Mutants/Phenotypes
    Strains/Constructs
    Pagani MA, et al. (2007) Disruption of iron homeostasis in Saccharomyces cerevisiae by high zinc levels: a genome-wide study. Mol Microbiol 65(2):521-37
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACO1 |ACO2 |ADE1 |ADE12 |ADE13 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADK1 |AFT1 |AKR1 |ARN1 |MORE
    Reviews
    Schulz TA and Prinz WA (2007) Sterol transport in yeast and the oxysterol binding protein homologue (OSH) family. Biochim Biophys Acta 1771(6):769-80
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AUS1 |CAT5 |DAN1 |ERG1 |ERG11 |ERG27 |ERG3 |ERG5 |ERG7 |HES1 |KES1 |MGM101 |NCR1 |NPC2 |MORE
    Genetic Interactions
    Strains/Constructs
    Shah Alam Bhuiyan M, et al. (2007) Synthetically lethal interactions involving loss of the yeast ERG24: the sterol C-14 reductase gene. Lipids 42(1):69-76
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |ERG2 |ERG24 |ERG28 |ERG3 |SUR4
    Large-scale phenotype analysis
    Yadav J, et al. (2007) A phenomics approach in yeast links proton and calcium pump function in the Golgi. Mol Biol Cell 18(4):1480-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  yfgdb  
    |CUP5 |ERG2 |ERG3 |ERG4 |GAL11 |GCN4 |GCN5 |HFI1 |NHP10 |OPI1 |PMR1 |RPN4 |SAC1 |SET3 |MORE
    Mutants/Phenotypes
    Strains/Constructs
    Das-Bradoo S, et al. (2006) Interaction between PCNA and diubiquitinated Mcm10 is essential for cell growth in budding yeast. Mol Cell Biol 26(13):4806-17
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |MCM10 |POL1 |POL30
    Mutants/Phenotypes
    Techniques and Reagents
    Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Grossmann G, et al. (2006) Lipid raft-based membrane compartmentation of a plant transport protein expressed in Saccharomyces cerevisiae. Eukaryot Cell 5(6):945-53
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Okamoto M, et al. (2006) Glycosylphosphatidylinositol-anchored proteins are required for the transport of detergent-resistant microdomain-associated membrane proteins Tat2p and Fur4p. J Biol Chem 281(7):4013-23
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |BUL1 |EAF3 |FUR4 |GWT1 |SSB1 |TAT2 |UBP5 |YDR266C
    Mutants/Phenotypes
    Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
    Cellular Location
    Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  yfgdb  
    |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
    Mutants/Phenotypes
    Strains/Constructs
    Sharma SC (2006) Implications of sterol structure for membrane lipid composition, fluidity and phospholipid asymmetry in Saccharomyces cerevisiae. FEMS Yeast Res 6(7):1047-51
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG2 |ERG3
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Shobayashi M, et al. (2006) A new method for isolation of S-adenosylmethionine (SAM)-accumulating yeast. Appl Microbiol Biotechnol 69(6):704-10
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG4
    Mutants/Phenotypes
    Strains/Constructs
    Simons V, et al. (2006) Dual effects of plant steroidal alkaloids on Saccharomyces cerevisiae. Antimicrob Agents Chemother 50(8):2732-40
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |ERG2 |ERG3
    Protein Processing/Modification/Regulation
    Techniques and Reagents
    Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |AAC1 |AAC3 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |MORE
    Genetic Interactions
    Mutants/Phenotypes
    Valachovic M, et al. (2006) Cumulative mutations affecting sterol biosynthesis in the yeast Saccharomyces cerevisiae result in synthetic lethality that is suppressed by alterations in sphingolipid profiles. Genetics 173(4):1893-908
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |BCK2 |ECM22 |ERG2 |ERG28 |ERG4 |ERG5 |GDA1 |HAP1 |HDA3 |IES1 |RDN25-1 |RDN37-1 |RPN9 |SSN2 |MORE
    Transcription
    Warringer J and Blomberg A (2006) Involvement of yeast YOL151W/GRE2 in ergosterol metabolism. Yeast 23(5):389-98
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |BGL2 |ENO1 |ERG10 |ERG11 |ERG2 |ERG24 |GRE2 |HMG1 |HMG2 |HXK1 |MVD1 |RNR4 |TDH1
    Cellular Location
    Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |AFG1 |AIM18 |ALD4 |ALO1 |ATP15 |ATP2 |ATP3 |ATP5 |AYR1 |BNA4 |CBR1 |CIR1 |COR1 |CYB2 |MORE
    Non-Fungal Related Genes/Proteins
    Zhou W, et al. (2006) Mechanistic analysis of a multiple product sterol methyltransferase implicated in ergosterol biosynthesis in Trypanosoma brucei. J Biol Chem 281(10):6290-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Mutants/Phenotypes
    van Voorst F, et al. (2006) Genome-wide identification of genes required for growth of Saccharomyces cerevisiae under ethanol stress. Yeast 23(5):351-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ASR1 |ATP1 |BEM2 |FAB1 |FEN1 |GCN5 |GIM4 |GIM5 |HMI1 |IMG1 |KAR3 |MSK1 |MSN2 |MTF2 |MORE
    Infection and Antifungals
    Mutants/Phenotypes
    Strains/Constructs
    Cowen LE and Lindquist S (2005) Hsp90 potentiates the rapid evolution of new traits: drug resistance in diverse fungi. Science 309(5744):2185-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CKA2 |CNA1 |CNB1 |CPR1 |ERG3 |HSC82 |LCL1 |PDR1 |PDR5 |RTC2 |SCS2 |YGR283C |YLR407W |YMR099C |MORE
    Reviews
    Henneberry AL and Sturley SL (2005) Sterol homeostasis in the budding yeast, Saccharomyces cerevisiae. Semin Cell Dev Biol 16(2):155-61
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |NCR1
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Kishimoto T, et al. (2005) Defects in structural integrity of ergosterol and the Cdc50p-Drs2p putative phospholipid translocase cause accumulation of endocytic membranes, onto which actin patches are assembled in yeast. Mol Biol Cell 16(12):5592-609
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ABP1 |ACT1 |BNI1 |CDC42 |CDC50 |DRS2 |ERG2 |ERG3 |ERG4 |ERG5 |GIC1 |LAS17 |SLA2 |SNC1
    RNA Levels and Processing
    Regulation of
    Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Liu Z, et al. (2005) A novel degron-mediated degradation of the RTG pathway regulator, Mks1p, by SCFGrr1. Mol Biol Cell 16(10):4893-904
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |BMH1 |GRR1 |MKS1 |RTG2
    Protein-protein Interactions
    Techniques and Reagents
    Mo C and Bard M (2005) A systematic study of yeast sterol biosynthetic protein-protein interactions using the split-ubiquitin system. Biochim Biophys Acta 1737(2-3):152-60
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG1 |ERG11 |ERG2 |ERG24 |ERG25 |ERG26 |ERG27 |ERG28 |ERG3 |ERG4 |ERG5 |ERG7 |ERG9
    Protein-protein Interactions
    Mo C and Bard M (2005) Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex. J Lipid Res 46(9):1991-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG1 |ERG11 |ERG25 |ERG26 |ERG27 |ERG28
    Mutants/Phenotypes
    Ott RG, et al. (2005) Flux of sterol intermediates in a yeast strain deleted of the lanosterol C-14 demethylase Erg11p. Biochim Biophys Acta 1735(2):111-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG11 |ERG3 |ERG7
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Proszynski TJ, et al. (2005) A genome-wide visual screen reveals a role for sphingolipids and ergosterol in cell surface delivery in yeast. Proc Natl Acad Sci U S A 102(50):17981-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AYR1 |BUD27 |CCZ1 |CHS5 |ERG4 |FAB1 |GIM3 |KES1 |LCB1 |MCH5 |MON1 |OPI9 |PAC10 |RVS161 |MORE
    Mutants/Phenotypes
    Sano T, et al. (2005) Regulation of the sphingoid long-chain base kinase Lcb4p by ergosterol and heme: studies in phytosphingosine-resistant mutants. J Biol Chem 280(44):36674-82
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |DPL1 |ERG2 |ERG3 |ERG4 |ERG5 |HAP1 |HEM14 |HMG1 |KES1 |LCB3 |LCB4 |PBP1 |PDR5 |TPS1 |MORE
    RNA Levels and Processing
    Shobayashi M, et al. (2005) Effects of Culture Conditions on Ergosterol Biosynthesis by Saccharomyces cerevisiae. Biosci Biotechnol Biochem 69(12):2381-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG13 |ERG2 |ERG20 |ERG24 |ERG26 |ERG28 |ERG3 |ERG5 |HMG1
    Mutants/Phenotypes
    Strains/Constructs
    Techniques and Reagents
    Walsh L, et al. (2005) Genetic modification and variations in solvent increase the sensitivity of the yeast RAD54-GFP genotoxicity assay. Mutagenesis 20(5):317-27
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |PDR5 |RAD54 |SNQ2 |YOR1
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Branco MR, et al. (2004) Decrease of H2O2 plasma membrane permeability during adaptation to H2O2 in Saccharomyces cerevisiae. J Biol Chem 279(8):6501-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |CCP1 |CTT1 |ERG3
    Mutants/Phenotypes
    Strains/Constructs
    Chang HJ, et al. (2004) Role of the unfolded protein response pathway in secretory stress and regulation of INO1 expression in Saccharomyces cerevisiae. Genetics 168(4):1899-913
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |HAC1 |INO1 |IRE1
    RNA Levels and Processing
    Regulation of
    Jones DL, et al. (2004) Genome-Wide Analysis of the Effects of Heat Shock on a Saccharomyces cerevisiae Mutant With a Constitutively Activated cAMP-Dependent Pathway. Comp Funct Genomics 5(5):419-31
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  
    |BTN2 |COX6 |DCS1 |ENO1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG26 |ERG27 |ERG3 |MORE
    RNA Levels and Processing
    Techniques and Reagents
    Krantz M, et al. (2004) Anaerobicity prepares Saccharomyces cerevisiae cells for faster adaptation to osmotic shock. Eukaryot Cell 3(6):1381-90
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  yfgdb  
    |ALD2 |ALD3 |ALD4 |ALD6 |CTT1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |MORE
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Markovich S, et al. (2004) Genomic approach to identification of mutations affecting caspofungin susceptibility in Saccharomyces cerevisiae. Antimicrob Agents Chemother 48(10):3871-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |BCK1 |CCR4 |CHC1 |CHS3 |CHS7 |CKA2 |CSG2 |ERG3 |ERG5 |FKS1 |ILM1 |MID2 |MNN10 |NPL3 |MORE
    Function/Process
    Protein-protein Interactions
    Strains/Constructs
    Mo C, et al. (2004) The ERG28-encoded protein, Erg28p, interacts with both the sterol C-4 demethylation enzyme complex as well as the late biosynthetic protein, the C-24 sterol methyltransferase (Erg6p). Biochim Biophys Acta 1686(1-2):30-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG11 |ERG28 |ERG3 |ERG7
    Cellular Location
    Mutants/Phenotypes
    Protein Sequence Features
    Strains/Constructs
    Mullner H, et al. (2004) Targeting of proteins involved in sterol biosynthesis to lipid particles of the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1663(1-2):9-13
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG1 |ERG7
    Mutants/Phenotypes
    Pannunzio VG, et al. (2004) A Simple Chemical Method for Rendering Wild-Type Yeast Permeable to Brefeldin A That Does Not Require the Presence of an erg6 Mutation. J Biomed Biotechnol 2004(3):150-155
    SGD Papers Entry  Pubmed Entry  

    Genomic expression study
    RNA Levels and Processing
    Regulation of
    Parveen M, et al. (2004) Response of Saccharomyces cerevisiae to a monoterpene: evaluation of antifungal potential by DNA microarray analysis. J Antimicrob Chemother 54(1):46-55
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  
    |AAD6 |ADH5 |ADH7 |ADY2 |AGA2 |AMS1 |ARG1 |ARN2 |ATF2 |ATX1 |BCK1 |BFR1 |BSC1 |BUD7 |MORE
    Cross-species Expression
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Pourshafie M, et al. (2004) Cloning of S-adenosyl-L-methionine:C-24-Delta-sterol-methyltransferase (ERG6) from Leishmania donovani and characterization of mRNAs in wild-type and amphotericin B-Resistant promastigotes. Antimicrob Agents Chemother 48(7):2409-14
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Mutants/Phenotypes
    Serrano R, et al. (2004) Copper and iron are the limiting factors for growth of the yeast Saccharomyces cerevisiae in an alkaline environment. J Biol Chem 279(19):19698-704
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  yfgdb  
    |AFT1 |ATX1 |BEM1 |BSD2 |BUD25 |CCC2 |CCS1 |COX17 |CTR1 |CUP5 |DIA2 |ERG2 |FET3 |FET4 |MORE
    Cellular Location
    Genetic Interactions
    Sorger D, et al. (2004) A yeast strain lacking lipid particles bears a defect in ergosterol formation. J Biol Chem 279(30):31190-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ARE1 |ARE2 |AYR1 |DGA1 |ERG1 |ERG7 |LRO1
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Tedrick K, et al. (2004) Enhanced membrane fusion in sterol-enriched vacuoles bypasses the Vrp1p requirement. Mol Biol Cell 15(10):4609-21
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |ACT1 |ARC35 |HUL4 |LAS17 |MIG1 |MKK1 |RRN5 |TOS2 |VAM3 |VPS33 |VPS5 |VRP1 |YPT7
    Regulation of
    Transcription
    Agarwal AK, et al. (2003) Genome-wide expression profiling of the response to polyene, pyrimidine, azole, and echinocandin antifungal agents in Saccharomyces cerevisiae. J Biol Chem 278(37):34998-5015
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |AGA1 |AMS1 |ATF2 |AUS1 |BAG7 |BAP2 |BAP3 |CRH1 |CTR1 |CWP1 |CYB5 |DAN1 |DAN4 |ELO1 |MORE
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Anderson JB, et al. (2003) Mode of selection and experimental evolution of antifungal drug resistance in Saccharomyces cerevisiae. Genetics 163(4):1287-98
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |CKA2 |ERG11 |ERG28 |ERG3 |LCL1 |PDR1 |PDR5 |RTC2 |SCS2 |SML1 |SNQ2 |SWH1 |YGR283C |YLR407W |MORE
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Techniques and Reagents
    Clark DD and Peterson BR (2003) Analysis of protein tyrosine kinase inhibitors in recombinant yeast lacking the ERG6 gene. Chembiochem 4(1):101-7
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  

    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Gupta SS, et al. (2003) Antifungal activity of amiodarone is mediated by disruption of calcium homeostasis. J Biol Chem 278(31):28831-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |CCH1 |CUP5 |ERG24 |ERG3 |MID1 |PDR5 |PMC1 |PMR1 |PTC1 |RCY1 |SSC1 |VCX1 |VPS45 |YPK1 |MORE
    Cellular Location
    Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
    SGD Papers Entry  Pubmed Entry  Web Supplement  yfgdb  
    |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Umebayashi K and Nakano A (2003) Ergosterol is required for targeting of tryptophan permease to the yeast plasma membrane. J Cell Biol 161(6):1117-31
    SGD Papers Entry  Pubmed Entry  
    |TAT2
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Valdez-Taubas J and Pelham HR (2003) Slow diffusion of proteins in the yeast plasma membrane allows polarity to be maintained by endocytic cycling. Curr Biol 13(18):1636-40
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACT1 |SNC1 |SSO1 |YBR016W
    Fungal Related Genes/Proteins
    Young LY, et al. (2003) Disruption of ergosterol biosynthesis confers resistance to amphotericin B in Candida lusitaniae. Antimicrob Agents Chemother 47(9):2717-24
    SGD Papers Entry  Pubmed Entry  
    |ERG3
    Regulation of
    Transcription
    Zhang W, et al. (2003) Microarray analyses of the metabolic responses of Saccharomyces cerevisiae to organic solvent dimethyl sulfoxide. J Ind Microbiol Biotechnol 30(1):57-69
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |AAH1 |ABP140 |ACS2 |ADE1 |ADE12 |ADE17 |ADE4 |ADE8 |ADH2 |ADH4 |ADH5 |ADK1 |ADO1 |ALD3 |MORE
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Bagnat M and Simons K (2002) Cell surface polarization during yeast mating. Proc Natl Acad Sci U S A 99(22):14183-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |BUL1 |BUL2 |FIG1 |FUS1 |FUS2 |GAP1 |HXT2 |LCB1 |LCB3 |PRM1 |SHO1 |STE6 |TRE1
    Mutants/Phenotypes
    Strains/Constructs
    Desmoucelles C, et al. (2002) Screening the yeast "disruptome" for mutants affecting resistance to the immunosuppressive drug, mycophenolic acid. J Biol Chem 277(30):27036-44
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ANP1 |BUD30 |CTK1 |CTK3 |DAL81 |DST1 |ERG24 |ERG3 |ERG4 |ERG5 |GCN5 |HOM2 |HPR1 |HTZ1 |MORE
    Function/Process
    Mutants/Phenotypes
    Dimmer KS, et al. (2002) Genetic basis of mitochondrial function and morphology in Saccharomyces cerevisiae. Mol Biol Cell 13(3):847-53
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ABF2 |ACO1 |ADA2 |ADK1 |AEP1 |AEP2 |AEP3 |AFG3 |AFT1 |AIM10 |AIM22 |ALY1 |APQ13 |ARG82 |MORE
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Eisenkolb M, et al. (2002) A specific structural requirement for ergosterol in long-chain fatty acid synthesis mutants important for maintaining raft domains in yeast. Mol Biol Cell 13(12):4414-28
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |GAS1 |PMA1 |SUR4
    Function/Process
    Emter R, et al. (2002) ERG6 and PDR5 regulate small lipophilic drug accumulation in yeast cells via distinct mechanisms. FEBS Lett 521(1-3):57-61
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |PDR5
    Function/Process
    Regulation of
    Transcription
    Hongay C, et al. (2002) Mot3 is a transcriptional repressor of ergosterol biosynthetic genes and is required for normal vacuolar function in Saccharomyces cerevisiae. EMBO J 21(15):4114-24
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG2 |ERG9 |MOT3 |PAN1 |VPS41
    Mutants/Phenotypes
    Strains/Constructs
    Marin S, et al. (2002) Promoter-specific inhibition of transcription by daunorubicin in Saccharomyces cerevisiae. Biochem J 368(Pt 1):131-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |GAL4 |PDR1 |PDR3 |PDR5
    Function/Process
    Mutants/Phenotypes
    Protein Physical Properties
    Protein Sequence Features
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Nes WD, et al. (2002) Active site mapping and substrate channeling in the sterol methyltransferase pathway. J Biol Chem 277(45):42549-56
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  

    Function/Process
    Mutants/Phenotypes
    Plowright AT, et al. (2002) Transcriptional response pathways in a yeast strain sensitive to saframycin a and a more potent analog: evidence for a common basis of activity. Chem Biol 9(5):607-18
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Web Supplement  
    |PDR1 |PDR3
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Kato M and Wickner W (2001) Ergosterol is required for the Sec18/ATP-dependent priming step of homotypic vacuole fusion. EMBO J 20(15):4035-40
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG3 |ERG4 |ERG5 |SEC17 |SEC18
    Cellular Location
    Function/Process
    Pichler H, et al. (2001) A subfraction of the yeast endoplasmic reticulum associates with the plasma membrane and has a high capacity to synthesize lipids. Eur J Biochem 268(8):2351-61
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG1 |ERG9
    Techniques and Reagents
    Sato M, et al. (2001) Yeast Saccharomyces cerevisiae has two cis-prenyltransferases with different properties and localizations. Implication for their distinct physiological roles in dolichol synthesis. Genes Cells 6(6):495-506
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |RER2 |SRT1
    Alias
    Shieh HL, et al. (2001) Biochemical analysis of fructose-1,6-bisphosphatase import into vacuole import and degradation vesicles reveals a role for UBC1 in vesicle biogenesis. J Biol Chem 276(13):10398-406
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |FBP1 |RPL40A |RPL40B |RPS31 |UBC1 |UBI4 |VID24
    Mutants/Phenotypes
    Strains/Constructs
    Sievi E, et al. (2001) Proteolytic function of GPI-anchored plasma membrane protease Yps1p in the yeast vacuole and Golgi. Traffic 2(12):896-907
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |HSP150 |PEP4 |SEC7 |YPS1
    Mutants/Phenotypes
    Strains/Constructs
    Bammert GF and Fostel JM (2000) Genome-wide expression patterns in Saccharomyces cerevisiae: comparison of drug treatments and genetic alterations affecting biosynthesis of ergosterol. Antimicrob Agents Chemother 44(5):1255-65
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG2 |ERG25 |ERG5 |RGI1 |TOS6
    Mutants/Phenotypes
    Strains/Constructs
    Inoue T, et al. (2000) Cloning and characterization of a gene complementing the mutation of an ethanol-sensitive mutant of sake yeast. Biosci Biotechnol Biochem 64(2):229-36
    SGD Papers Entry  Pubmed Entry  

    Reviews
    Nes WD (2000) Sterol methyl transferase: enzymology and inhibition. Biochim Biophys Acta 1529(1-3):63-88
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Sitcheran R, et al. (2000) A genetic analysis of glucocorticoid receptor signaling. Identification and characterization of ligand-effect modulators in Saccharomyces cerevisiae. Genetics 156(3):963-72
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |LEM3 |PDR5
    Reviews
    Sturley SL (2000) Conservation of eukaryotic sterol homeostasis: new insights from studies in budding yeast. Biochim Biophys Acta 1529(1-3):155-63
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ARE1 |ARE2 |ARH1 |ARV1 |ECM22 |ERG10 |ERG11 |ERG9 |HMG1 |HMG2 |HMS1 |LRO1 |NCR1 |ROX1 |MORE
    Mutants/Phenotypes
    Zweytick D, et al. (2000) Biochemical characterization and subcellular localization of the sterol C-24(28) reductase, erg4p, from the yeast saccharomyces cerevisiae. FEBS Lett 470(1):83-7
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG4
    Reviews
    Zweytick D, et al. (2000) Intracellular lipid particles of eukaryotic cells. Biochim Biophys Acta 1469(2):101-20
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AYR1 |EHT1 |ERG1 |ERG7 |FAA1 |FAA4 |FAT1 |NUS1 |PET10 |SLC1 |TDH1 |TDH2 |TDH3 |TGL1 |MORE
    Cellular Location
    Athenstaedt K, et al. (1999) Identification and characterization of major lipid particle proteins of the yeast Saccharomyces cerevisiae. J Bacteriol 181(20):6441-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |EHT1 |ERG1 |ERG7 |FAA1 |FAA4 |FAT1 |NUS1 |PET10 |TGL1 |TGL3 |YJU3 |YOR059C
    Genomic expression study
    Regulation of
    Dimster-Denk D, et al. (1999) Comprehensive evaluation of isoprenoid biosynthesis regulation in Saccharomyces cerevisiae utilizing the Genome Reporter Matrix. J Lipid Res 40(5):850-60
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ARE1 |ARE2 |BEM1 |BET2 |BET4 |BTS1 |CAT5 |CDC43 |COQ1 |COQ2 |COQ3 |COQ6 |COX10 |ERG1 |MORE
    Mutants/Phenotypes
    Strains/Constructs
    Kaur R and Bachhawat AK (1999) The yeast multidrug resistance pump, Pdr5p, confers reduced drug resistance in erg mutants of Saccharomyces cerevisiae. Microbiology 145 ( Pt 4)():809-18
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CHO1 |ERG2 |ERG3 |ERG4 |PDR5
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Munn AL, et al. (1999) Specific sterols required for the internalization step of endocytosis in yeast. Mol Biol Cell 10(11):3943-57
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG2
    Non-Fungal Related Genes/Proteins
    Protein Sequence Features
    Niewmierzycka A and Clarke S (1999) S-Adenosylmethionine-dependent methylation in Saccharomyces cerevisiae. Identification of a novel protein arginine methyltransferase. J Biol Chem 274(2):814-24
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ABD1 |ABP140 |BDH2 |BUD23 |COQ3 |COQ5 |COX1 |CRG1 |DIM1 |GCD14 |HMT1 |MET1 |MNI1 |MTQ2 |MORE
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Chabane S, et al. (1998) Over-expression of the yeast BFR2 gene partially suppresses the growth defects induced by Brefeldin A and by four ER-to-Golgi mutations. Curr Genet 33(1):21-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |BFR2 |SEC13 |SEC16 |SEC23 |YPT1
    Reviews
    Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
    Genetic Interactions
    Strains/Constructs
    Jensen-Pergakes KL, et al. (1998) Sequencing, disruption, and characterization of the Candida albicans sterol methyltransferase (ERG6) gene: drug susceptibility studies in erg6 mutants. Antimicrob Agents Chemother 42(5):1160-7
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Cellular Location
    Leber R, et al. (1998) Dual localization of squalene epoxidase, Erg1p, in yeast reflects a relationship between the endoplasmic reticulum and lipid particles. Mol Biol Cell 9(2):375-86
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG1 |KAR2
    Function/Process
    Protein Physical Properties
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Techniques and Reagents
    Nes WD, et al. (1998) Overexpression, purification, and stereochemical studies of the recombinant (S)-adenosyl-L-methionine: delta 24(25)- to delta 24(28)-sterol methyl transferase enzyme from Saccharomyces cerevisiae. Arch Biochem Biophys 353(2):297-311
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Function/Process
    Substrates/Ligands/Cofactors
    Acuna-Johnson AP, et al. (1997) Stereochemistry of yeast delta 24-sterol methyl transferase. Bioorg Med Chem 5(5):821-32
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Gachotte D, et al. (1997) A yeast sterol auxotroph (erg25) is rescued by addition of azole antifungals and reduced levels of heme. Proc Natl Acad Sci U S A 94(21):11173-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG11 |ERG25 |HEM2 |HEM4
    Cross-species Expression
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Grebenok RJ, et al. (1997) Characterization of Zea mays endosperm C-24 sterol methyltransferase: one of two types of sterol methyltransferase in higher plants. Plant Mol Biol 34(6):891-6
    SGD Papers Entry  Pubmed Entry  

    Function/Process
    Protein Processing/Modification/Regulation
    Protein-protein Interactions
    Nes WD, et al. (1997) Substrate-based inhibitors of the (S)-adenosyl-L-methionine:delta24(25)- to delta24(28)-sterol methyl transferase from Saccharomyces cerevisiae. Arch Biochem Biophys 342(1):68-81
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Genetic Interactions
    Mutants/Phenotypes
    Regulatory Role
    Strains/Constructs
    Arthington-Skaggs BA, et al. (1996) Positive and negative regulation of a sterol biosynthetic gene (ERG3) in the post-squalene portion of the yeast ergosterol pathway. FEBS Lett 392(2):161-5
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ARE1 |ARE2 |ERG2 |ERG3 |ERG4 |ERG5
    Genetic Interactions
    Fang M, et al. (1996) Kes1p shares homology with human oxysterol binding protein and participates in a novel regulatory pathway for yeast Golgi-derived transport vesicle biogenesis. EMBO J 15(23):6447-59
    SGD Papers Entry  Pubmed Entry  
    |ERG3 |HES1 |HMG1 |HMG2 |KES1 |SEC14 |SWH1
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Hemenway CS and Heitman J (1996) Immunosuppressant target protein FKBP12 is required for P-glycoprotein function in yeast. J Biol Chem 271(31):18527-34
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CNB1 |CPR1 |FPR1 |RAD52 |STE6 |VMA22
    Alias
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Hoffman M and Chiang HL (1996) Isolation of degradation-deficient mutants defective in the targeting of fructose-1,6-bisphosphatase into the vacuole for degradation in Saccharomyces cerevisiae. Genetics 143(4):1555-66
    SGD Papers Entry  Pubmed Entry  
    |FBP1
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Husselstein T, et al. (1996) Transformation of Saccharomyces cerevisiae with a cDNA encoding a sterol C-methyltransferase from Arabidopsis thaliana results in the synthesis of 24-ethyl sterols. FEBS Lett 381(1-2):87-92
    SGD Papers Entry  Pubmed Entry  

    Alias
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Lee DH and Goldberg AL (1996) Selective inhibitors of the proteasome-dependent and vacuolar pathways of protein degradation in Saccharomyces cerevisiae. J Biol Chem 271(44):27280-4
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Function/Process
    Protein Physical Properties
    Substrates/Ligands/Cofactors
    Venkatramesh M, et al. (1996) Mechanism and structural requirements for transformation of substrates by the (S)-adenosyl-L-methionine:delta 24(25)-sterol methyl transferase from Saccharomyces cerevisiae. Biochim Biophys Acta 1299(3):313-24
    SGD Papers Entry  Pubmed Entry  
    |ERG7
    Regulation of
    Substrates/Ligands/Cofactors
    Techniques and Reagents
    Venkatramesh M, et al. (1996) Sterol specificity of the Saccharomyces cerevisiae ERG6 gene product expressed in Escherichia coli. Lipids 31(4):373-7
    SGD Papers Entry  Pubmed Entry  

    Mutants/Phenotypes
    Strains/Constructs
    Espinet C, et al. (1995) An efficient method to isolate yeast genes causing overexpression-mediated growth arrest. Yeast 11(1):25-32
    SGD Papers Entry  Pubmed Entry  
    |ACT1 |AFT1 |ARF2 |ATE1 |AUA1 |HSF1 |MCM1 |NHP6A |NSR1 |NTH1 |RHO1 |SEC17 |SHE1 |SHE10 |MORE
    Reviews
    Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6
    SGD Papers Entry  Pubmed Entry  
    |ERG1 |ERG11 |ERG2 |ERG24 |ERG3 |ERG4 |ERG5 |ERG7 |ERG9 |FEN1 |FEN2
    Reviews
    Parks LW and Casey WM (1995) Physiological implications of sterol biosynthesis in yeast. Annu Rev Microbiol 49:95-116
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |ERG3 |ERG4 |ERG5 |ERG7 |ERG8 |MORE
    Reviews
    Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30
    SGD Papers Entry  Pubmed Entry  
    |ERG1 |ERG10 |ERG11 |ERG12 |ERG2 |ERG20 |ERG24 |ERG3 |ERG4 |ERG5 |ERG7 |ERG8 |ERG9 |HMG1 |MORE
    Cell Cycle Phase Involved
    Mutants/Phenotypes
    Strains/Constructs
    Prendergast JA, et al. (1995) Mutations sensitizing yeast cells to the start inhibitor nalidixic acid. Yeast 11(6):537-47
    SGD Papers Entry  Pubmed Entry  
    |ARO7 |ERG3
    Mutants/Phenotypes
    Strains/Constructs
    Techniques and Reagents
    Rambourg A, et al. (1995) Effects of brefeldin A on the three-dimensional structure of the Golgi apparatus in a sensitive strain of Saccharomyces cerevisiae. Anat Rec 241(1):1-9
    SGD Papers Entry  Pubmed Entry  
    |ARF1
    Alias
    Genetic Interactions
    Mapping
    Mutants/Phenotypes
    Protein Sequence Features
    Hardwick KG and Pelham HR (1994) SED6 is identical to ERG6, and encodes a putative methyltransferase required for ergosterol synthesis. Yeast 10(2):265-9
    SGD Papers Entry  Pubmed Entry  
    |ERD2
    Cellular Location
    Mutants/Phenotypes
    Strains/Constructs
    Techniques and Reagents
    Leber R, et al. (1994) Characterization of lipid particles of the yeast, Saccharomyces cerevisiae. Yeast 10(11):1421-8
    SGD Papers Entry  Pubmed Entry  

    Alias
    Mutants/Phenotypes
    Strains/Constructs
    Welihinda AA, et al. (1994) Mutations in LIS1 (ERG6) gene confer increased sodium and lithium uptake in Saccharomyces cerevisiae. Biochim Biophys Acta 1193(1):107-17
    SGD Papers Entry  Pubmed Entry  

    Alias
    Mutants/Phenotypes
    Strains/Constructs
    Graham TR, et al. (1993) Brefeldin A reversibly blocks early but not late protein transport steps in the yeast secretory pathway. EMBO J 12(3):869-77
    SGD Papers Entry  Pubmed Entry  
    |PRC1
    Mutants/Phenotypes
    Strains/Constructs
    Shah N and Klausner RD (1993) Brefeldin A reversibly inhibits secretion in Saccharomyces cerevisiae. J Biol Chem 268(8):5345-8
    SGD Papers Entry  Pubmed Entry  

    Mutants/Phenotypes
    Strains/Constructs
    Vogel JP, et al. (1993) Brefeldin A causes a defect in secretion in Saccharomyces cerevisiae. J Biol Chem 268(5):3040-3
    SGD Papers Entry  Pubmed Entry  

    Mutants/Phenotypes
    Strains/Constructs
    Techniques and Reagents
    Heiderpriem RW, et al. (1992) A simple method for the isolation of zymosterol from a sterol mutant of Saccharomyces cerevisiae. J Steroid Biochem Mol Biol 43(7):741-3
    SGD Papers Entry  Pubmed Entry  
    |ERG2
    Reviews
    Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
    SGD Papers Entry  
    |ACC1 |ACH1 |CDS1 |CHO1 |CHO2 |CKI1 |CTR1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |MORE
    Cell Cycle Phase Involved
    Function/Process
    Mapping
    Mutants/Phenotypes
    Strains/Constructs
    Gaber RF, et al. (1989) The yeast gene ERG6 is required for normal membrane function but is not essential for biosynthesis of the cell-cycle-sparking sterol. Mol Cell Biol 9(8):3447-56
    SGD Papers Entry  Pubmed Entry  
    |SEC59
    Mutants/Phenotypes
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Lorenz RT, et al. (1989) Structural discrimination in the sparking function of sterols in the yeast Saccharomyces cerevisiae. J Bacteriol 171(11):6169-73
    SGD Papers Entry  Pubmed Entry  
    |ERG7 |HEM1
    Mutants/Phenotypes
    Strains/Constructs
    Techniques and Reagents
    Xu SH and Nes WD (1988) Biosynthesis of cholesterol in the yeast mutant erg6. Biochem Biophys Res Commun 155(1):509-17
    SGD Papers Entry  Pubmed Entry  

    Cell Cycle Phase Involved
    Cellular Location
    Mapping
    Mutants/Phenotypes
    Strains/Constructs
    Techniques and Reagents
    McCammon MT, et al. (1984) Sterol methylation in Saccharomyces cerevisiae. J Bacteriol 157(2):475-83
    SGD Papers Entry  Pubmed Entry  
    |ERG3
    Function/Process
    Protein Processing/Modification/Regulation
    Substrates/Ligands/Cofactors
    Oehlschlager AC, et al. (1984) Azasterol inhibition of delta 24-sterol methyltransferase in Saccharomyces cerevisiae. Biochemistry 23(16):3582-9
    SGD Papers Entry  Pubmed Entry  

    Function/Process
    Protein Physical Properties
    Substrates/Ligands/Cofactors
    Hata S, et al. (1982) Effect of detergents on sterol synthesis in a cell-free system of yeast. J Lipid Res 23(6):803-10
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ERG1 |ERG9
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Techniques and Reagents
    Kleinhans FW, et al. (1979) ESR determinations of membrane permeability in a yeast sterol mutant. Chem Phys Lipids 23(2):143-54
    SGD Papers Entry  Pubmed Entry  
    |ERG2
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Lees ND, et al. (1979) ESR determination of membrane order parameter in yeast sterol mutants. Biochim Biophys Acta 553(3):469-75
    SGD Papers Entry  Pubmed Entry  
    |ERG2
    Function/Process
    Pierce AM, et al. (1979) Azasterol inhibitors in yeast. Inhibition of the delta 24-sterol methyltransferase and the 24-methylene sterol delta 24(28)-reductase in sterol mutants of Saccharomyces cerevisiae. Can J Biochem 57(3):201-8
    SGD Papers Entry  Pubmed Entry  
    |ERG2 |ERG5
    Regulation of
    Parks LW, et al. (1978) Sterols in yeast subcellular fractions. Lipids 13(10):730-5
    SGD Papers Entry  Pubmed Entry  
    |ERG24 |ERG4
    Function/Process
    Fungal Related Genes/Proteins
    Mutants/Phenotypes
    Strains/Constructs
    Pierce AM, et al. (1978) Metabolism of delta24-sterols by yeast mutants blocked in removal of the C-14 methyl group. Can J Biochem 56(8):794-800
    SGD Papers Entry  Pubmed Entry  

    Function/Process
    Protein Processing/Modification/Regulation
    Pierce HD Jr, et al. (1978) Azasterol inhibitors in yeast. Inhibition of the 24-methylene sterol delta24(28)-reductase and delta24-sterol methyltransferase of Saccharomyces cerevisiae by 23-azacholesterol. Biochim Biophys Acta 529(3):429-37
    SGD Papers Entry  Pubmed Entry  
    |ERG4
    Mutants/Phenotypes
    Strains/Constructs
    Techniques and Reagents
    Bard M, et al. (1977) Sterol mutants of Saccharomyces cerevisiae: chromatographic analyses. Lipids 12(8):645-54
    SGD Papers Entry  Pubmed Entry  
    |ERG2 |ERG3 |ERG5
    Function/Process
    Bailey RB, et al. (1976) Homoazasterol-mediated inhibition of yeast sterol biosynthesis. J Bacteriol 128(3):730-4
    SGD Papers Entry  Pubmed Entry  

    Cellular Location
    Function/Process
    Protein Processing/Modification/Regulation
    Substrates/Ligands/Cofactors
    Bailey RB and Parks LW (1975) Potassium translocation in yeast mitochondria and its relationship to ergostrol biosynthesis. J Bacteriol 122(2):606-9
    SGD Papers Entry  Pubmed Entry  

    Regulation of
    Substrates/Ligands/Cofactors
    Moore JT Jr and Gaylor JL (1970) Investigation of an S-adenosylmethionine: delta 24-sterol methyltransferase in ergosterol biosynthesis in yeast. Specificity of sterol substrates and inhibitors. J Biol Chem 245(18):4684-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Alias
    Function/Process
    Protein Physical Properties
    Substrates/Ligands/Cofactors
    Moore JT and Gaylor JL (1969) Isolation and purification of an S-adenosylmethionine: delta 24-sterol methyltransferase from yeast. J Biol Chem 244(23):6334-40
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  


    Return to SGD
    Send a Message to the SGD Curators

    SGDtm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.