ERG6/YML008C Single Page Format |
|
Contents
- Names and Identifiers
- GO Annotations
- Pathways
- Summary Paragraph
- Mutant Phenotypes
- Interactions
- Homologs
- Protein Info (physical properties, transcript info)
- PDB Homologs (protein structure info)
- Motifs
- Genome-wide Expression
(and other large-scale analyses)- Locus History (misc. notes)
- Sequence Retrieval and Analysis
- Map and Displays
- Localization
- Community Annotation
- Literature Guide
Sequence Coordinates
  ChrXIII: 252990 to 251839
CDS: 252990 - 251839
Genetic position: 2 cM
Genetic Map DataClick on map for expanded view
SGD ORF map GBrowse SGD Locus Page
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Standard Name | Systematic Name | Alias | Feature Type | SGDID | ||||
| ERG6 | YML008C | ISE1, LIS1, SED6, VID1 | ORF, Verified | S000004467 | ||||
| Description | ||||||||
| Delta(24)-sterol C-methyltransferase, converts zymosterol to fecosterol in the ergosterol biosynthetic pathway by methylating position C-24; localized to both lipid particles and mitochondrial outer membrane | ||||||||
| |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| ergosterol biosynthesis | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
| |||||||
|---|---|---|---|---|---|---|---|
| Phenotype page for ERG6/YML008C | |||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Interaction page for ERG6/YML008C | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 10 20 30 40 50
| | | | |
MSETELRKRQAQFTRELHGDDIGKKTGLSALMSKNNSAQKEAVQKYLRNW
DGRTDKDAEERRLEDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGESF
AASIARHEHYLAYKAGIQRGDLVLDVGCGVGGPAREIARFTGCNVIGLNN
NDYQIAKAKYYAKKYNLSDQMDFVKGDFMKMDFEENTFDKVYAIEATCHA
PKLEGVYSEIYKVLKPGGTFAVYEWVMTDKYDENNPEHRKIAYEIELGDG
IPKMFHVDVARKALKNCGFEVLVSEDLADNDDEIPWYYPLTGEWKYVQNL
ANLATFFRTSYLGRQFTTAMVTVMEKLGLAPEGSKEVTAALENAAVGLVA
GGKSKLFTPMMLFVARKPENAETPSQTSQEATQ*
| ||||||||||||||||||||||||||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||
|---|---|---|---|---|---|
| You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses. | |||||
| ||||
|---|---|---|---|---|
| Nomenclature History |
|---|
| Standard Name | Reference |
|---|---|
| ERG6 | SGD (2007) Information without a citation in SGD |
| Mapping Notes |
| |||||
|---|---|---|---|---|---|
| Sequence Type | Output Format | ||||
| Genomic DNA | GCG | FASTA | NoHeader | ||||
| Genomic DNA with 1 kb up and downstream | GCG | FASTA | NoHeader | ||||
| DNA coding sequence (without introns, without flanking regions) | GCG | FASTA | NoHeader | ||||
| Protein Translation of ORF | GCG | FASTA | NoHeader | ||||
| 6-Frame Translation(with Restriction Map) | GCG | ||||
| Restriction Fragment Sizes | GCG | ||||
| Sequence from other databases | |
|---|---|
| Sequence ID | Source |
| YML008C | SGD Systematic Sequence |
| 855003 | NCBI: Gene ID |
| NP_013706.1 | NCBI: RefSeq protein version ID |
| NP_013706.1 | NCBI: RefSeq protein version ID |
| 6323635 | NCBI: NCBI protein GI |
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Physical, Genetic Maps: | Chromosomal Feature Map | GBrowse | Combined Physical and Genetic Map | Genetic Distance vs. Physical Distance Ratios | ||||
| Similarity Viewers: | Synteny Viewer | Genomic Stripe View | SAGE Results Map |   | ||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No community annotation available. | |||||||||
| ||||||
|---|---|---|---|---|---|---|
| Topics | Reference | Other Genes Addressed | 171 curated references; 0 references not yet curated | |||
| Genetic Interactions Mutants/Phenotypes | Hodg CA, et al. (2010) Integral membrane proteins Brr6 and Apq12 link assembly of the nuclear pore complex to lipid homeostasis in the endoplasmic reticulum. J Cell Sci 123(Pt 1):141-151 | |ACC1 |APQ12 |ARE1 |ARE2 |ARV1 |BRR6 |DGA1 |ELO1 |ERG2 |ERG3 |ERG4 |ERG5 |FEN1 |LRO1 |MORE | ||||
| Regulation of | Zeng T and Li J (2010) Maximization of negative correlations in time-course gene expression data for enhancing understanding of molecular pathways. Nucleic Acids Res 38(1):e1 | |ACO2 |ADR1 |CAB2 |CAT8 |CIT1 |ERG2 |ERG26 |ERG27 |ERG4 |ERG5 |GCN4 |GTT1 |HAP1 |HAP3 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Abe F and Hiraki T (2009) Mechanistic role of ergosterol in membrane rigidity and cycloheximide resistance in Saccharomyces cerevisiae. Biochim Biophys Acta 1788(3):743-52 | |ERG2 |ERG3 |ERG4 |ERG5 |PDR5 |UPC2 | ||||
| Mutants/Phenotypes Strains/Constructs | Banuelos MG, et al. (2009) Genomic analysis of severe hypersensitivity to hygromycin B reveals linkage to vacuolar defects and new vacuolar gene functions in Saccharomyces cerevisiae. Curr Genet | |ARF1 |BUD32 |BUR2 |CHC1 |CIN5 |CPA1 |DBP7 |DHH1 |DRS2 |GET2 |GLN3 |HHY1 |ISM1 |MCT1 |MORE | ||||
| Regulation of | Bruckmann A, et al. (2009) Proteome analysis of aerobically and anaerobically grown Saccharomyces cerevisiae cells. J Proteomics 71(6):662-9 | |ACH1 |ACS1 |ACS2 |ADE17 |ADH1 |ADH2 |ALD4 |ALD6 |APE2 |ARP3 |ASC1 |ASN1 |ATP1 |ATP2 |MORE | ||||
| Other Features | Connerth M, et al. (2009) Analysis of lipid particles from yeast. Methods Mol Biol 579:359-74 | |AYR1 |ERG1 |ERG7 |POR1 |PRC1 |SEC61 |WBP1 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Daicho K, et al. (2009) Sorting defects of the tryptophan permease Tat2 in an erg2 yeast mutant. FEMS Microbiol Lett 298(2):218-27 | |ERG2 |ERG3 |ERG4 |ERG5 |TAT2 |TRP1 | ||||
| Reviews | Ding J, et al. (2009) Tolerance and stress response to ethanol in the yeast Saccharomyces cerevisiae. Appl Microbiol Biotechnol 85(2):253-63 | |ADA2 |ASR1 |ATP1 |BEM2 |CHD1 |CTT1 |DDR2 |ERO1 |FEN1 |GCN5 |GIM4 |GIM5 |HFI1 |HMI1 |MORE | ||||
| Reviews | Goodman JM (2009) Demonstrated and inferred metabolism associated with cytosolic lipid droplets. J Lipid Res 50(11):2148-56 | |AYR1 |DGA1 |EHT1 |ERG1 |ERG26 |ERG27 |ERG7 |FAA1 |FAA4 |FAT1 |SLC1 |TGL1 |TGL3 |TGL4 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Jones L, et al. (2009) Cdc42p is activated during vacuole membrane fusion in a sterol-dependent subreaction of priming. J Biol Chem | |CDC42 |ERG2 |ERG3 |ERG4 |ERG5 |RDI1 |SEC17 |SEC18 |STE20 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Muthusamy BP, et al. (2009) Control of protein and sterol trafficking by antagonistic activities of a type IV P-type ATPase and oxysterol binding protein homologue. Mol Biol Cell 20(12):2920-31 | |CPS1 |DNF1 |DNF2 |DNF3 |DRS2 |GGA1 |GGA2 |KES1 |PHO8 |PRC1 |SAC1 |SNC1 | ||||
| RNA Levels and Processing | Pedroso N, et al. (2009) Modulation of plasma membrane lipid profile and microdomains by H(2)O(2) in Saccharomyces cerevisiae. Free Radic Biol Med 46(2):289-98 | |ACC1 |ELO1 |ERG1 |ERG25 |ERG3 |ERG7 |FAS1 |FEN1 |GPT2 |LAC1 |LIP1 |OLE1 |RAD27 |SUR4 | ||||
| Reviews | Petrossian T and Clarke S (2009) Bioinformatic identification of novel methyltransferases Epigenomics 1(1):163-175 | |ABD1 |ABP140 |AML1 |BIO2 |BUD23 |CHO2 |COQ3 |COQ5 |CRG1 |CTM1 |DIM1 |DOT1 |DPH5 |ELP3 |MORE | ||||
| Protein Sequence Features | Petrossian TC and Clarke SG (2009) Multiple Motif Scanning to identify methyltransferases from the yeast proteome. Mol Cell Proteomics 8(7):1516-26 | |COQ3 |COQ5 |CRG1 |MAM3 |OMS1 |PPM2 |RSM22 |SEE1 |SPE3 |SPE4 |TMT1 |TRM12 |TRM9 |TYW3 |MORE | ||||
| Regulation of Transcription | Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461 | |AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE | ||||
| Function/Process Protein Processing/Modification/Regulation | Rossignol T, et al. (2009) The proteome of a wine yeast strain during fermentation, correlation with the transcriptome. J Appl Microbiol 107(1):47-55 | |ACT1 |ADE5,7 |ADH1 |AHP1 |ARO9 |ASC1 |ASN1 |CDC48 |CYS3 |EFT1 |ENO1 |ENO2 |FBA1 |GDH1 |MORE | ||||
| Large-scale phenotype analysis | Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508 | |AAT2 |ADO1 |AIM26 |ALG7 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |CSG2 |ELP2 |ERG2 |MORE | ||||
| Mutants/Phenotypes | Yoshikawa K, et al. (2009) Comprehensive phenotypic analysis for identification of genes affecting growth under ethanol stress in Saccharomyces cerevisiae. FEMS Yeast Res 9(1):32-44 | |ALD6 |ARO1 |ARO2 |ARO7 |COQ10 |COQ5 |COQ9 |COX11 |COX12 |COX14 |COX16 |COX18 |COX23 |COX7 |MORE | ||||
| Cell Growth and Metabolism Function/Process Strains/Constructs | Zhang Z, et al. (2009) [Regulation role of sterol C-24 methyltransferase and sterol C-8 isomerase in the ergosterol biosynthesis of Saccharomyces cerevisiae] Wei Sheng Wu Xue Bao 49(8):1063-8 | |ERG2 | ||||
| Mutants/Phenotypes Strains/Constructs | de Graaf B, et al. (2009) Cellular pathways for DNA repair and damage tolerance of formaldehyde-induced DNA-protein crosslinks. DNA Repair (Amst) 8(10):1207-14 | |ADH1 |ARP5 |BEM4 |CDC26 |CDC50 |CTF4 |DAL81 |ECM30 |ERG3 |ERG5 |LSM1 |MED1 |MGM101 |MMS22 |MORE | ||||
| Mutants/Phenotypes | Folmer V, et al. (2008) H(2)O(2) induces rapid biophysical and permeability changes in the plasma membrane of Saccharomyces cerevisiae. Biochim Biophys Acta 1778(4):1141-7 | |ERG3 | ||||
| Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs | Ganapathy K, et al. (2008) Molecular probing of the Saccharomyces cerevisiae sterol 24-C methyltransferase reveals multiple amino acid residues involved with C(2)-transfer activity. Biochim Biophys Acta 1781(6-7):344-51 | |||||
| Mutants/Phenotypes Strains/Constructs | Grossmann G, et al. (2008) Plasma membrane microdomains regulate turnover of transport proteins in yeast. J Cell Biol 183(6):1075-88 | |CAN1 |CAX4 |COG1 |ELP6 |ERG2 |ERG24 |ERG5 |FUR4 |FYV6 |GOS1 |HNT3 |MDG1 |MNN10 |MNN11 |MORE | ||||
| Fungal Related Genes/Proteins | Iwaki T, et al. (2008) Multiple functions of ergosterol in the fission yeast Schizosaccharomyces pombe. Microbiology 154(Pt 3):830-41 | |ERG2 |ERG3 |ERG4 |ERG5 | ||||
| Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Physical Properties Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors | Jayasimha P and Nes WD (2008) Photoaffinity Labeling and Mutational Analysis of 24-C-Sterol Methyltransferase Defines the AdoMet Binding Site. Lipids 43(8):681-93 | |||||
| Genetic Interactions Mutants/Phenotypes | Jin H, et al. (2008) Ergosterol promotes pheromone signaling and plasma membrane fusion in mating yeast. J Cell Biol 180(4):813-26 | |ERG2 |ERG3 |LCB1 |PRM1 |STE5 | ||||
| Mutants/Phenotypes Protein-protein Interactions Strains/Constructs | Khoury CM, et al. (2008) A TSC22-like motif defines a novel antiapoptotic protein family. FEMS Yeast Res 8(4):540-63 | |ACA1 |ARR1 |CAD1 |CIN5 |CST6 |FYV10 |GCN4 |HAC1 |KCS1 |MCA1 |MET28 |NKP1 |RTG1 |RTG3 |MORE | ||||
| Translational Regulation | Melamed D, et al. (2008) Yeast translational response to high salinity: global analysis reveals regulation at multiple levels. RNA 14(7):1337-51 | |ADK1 |AIM17 |ALD3 |AQR1 |ARG2 |ARG3 |ARG5,6 |ARG7 |ARG80 |ARG81 |ARG82 |AST1 |BCY1 |BTN2 |MORE | ||||
| Function/Process Mutants/Phenotypes Protein Physical Properties Protein Processing/Modification/Regulation Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs Substrates/Ligands/Cofactors | Nes WD, et al. (2008) Yeast sterol C24-methyltransferase: role of highly conserved tyrosine-81 in catalytic competence studied by site-directed mutagenesis and thermodynamic analysis. Arch Biochem Biophys 477(2):313-23 | |||||
| Mutants/Phenotypes Strains/Constructs | Rojas M, et al. (2008) Genomewide expression profiling of cryptolepine-induced toxicity in Saccharomyces cerevisiae. Antimicrob Agents Chemother 52(11):3844-50 | |AFT1 |ALD3 |ARN1 |ARN2 |CCP1 |CDC19 |CIS3 |CTT1 |DAN1 |ECM33 |EGT2 |ENO2 |ERV1 |EXG2 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67 | |AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Serero A, et al. (2008) Yeast genes involved in cadmium tolerance: Identification of DNA replication as a target of cadmium toxicity. DNA Repair (Amst) 7(8):1262-75 | |ADA2 |ARP5 |ATP1 |BRO1 |BUR2 |CCR4 |CCS1 |CTF4 |CTR1 |CUP2 |CYS4 |DID4 |DNA2 |DOA4 |MORE | ||||
| Mutants/Phenotypes | Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90 | |ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ARV1 |ATG17 |ATP17 |BDF1 |BEM1 |MORE | ||||
| Cellular Location Other Features Strains/Constructs | Takeda Y and Nakano A (2008) In vitro Formation of a Novel Type of Membrane Vesicles Containing Dpm1p: Putative Transport Vesicles for Lipid Droplets in Budding Yeast. J Biochem 143(6):803-11 | |DPM1 | ||||
| Mutants/Phenotypes Strains/Constructs | Tang F, et al. (2008) A life-span extending form of autophagy employs the vacuole-vacuole fusion machinery. Autophagy 4(7):874-86 | |ATG1 |ATG10 |ATG11 |ATG15 |ATG17 |ATG22 |ATG7 |ATG8 |AVT3 |AVT4 |ERG2 |ERG28 |ERG5 |GSG1 |MORE | ||||
| Mutants/Phenotypes | Ulanovskaya OA, et al. (2008) Synthesis enables identification of the cellular target of leucascandrolide A and neopeltolide. Nat Chem Biol 4(7):418-24 | |ATG11 |COB |COR1 |CYT1 |ERG3 |HOM3 |KCS1 |PPA1 |QCR10 |QCR2 |QCR6 |QCR7 |QCR8 |QCR9 |MORE | ||||
| Cellular Location Strains/Constructs | Vorvis C, et al. (2008) Photoactivatable GFP tagging cassettes for protein-tracking studies in the budding yeast Saccharomyces cerevisiae. Yeast 25(9):651-9 | |NUM1 | ||||
| Genetic Interactions Infection and Antifungals Mutants/Phenotypes Strains/Constructs | Welscher YM, et al. (2008) Natamycin Blocks Fungal Growth by Binding Specifically to Ergosterol without Permeabilizing the Membrane. J Biol Chem 283(10):6393-401 | |ERG2 |ERG3 |ERG4 |ERG5 | ||||
| Cross-species Expression Disease Gene Related Mutants/Phenotypes Strains/Constructs | Zabrocki P, et al. (2008) Phosphorylation, lipid raft interaction and traffic of alpha-synuclein in a yeast model for Parkinson. Biochim Biophys Acta 1783(10):1767-80 | |CKA1 |CKA2 |CKB1 |CKB2 |DOA4 |ERG24 |ERG28 |MAK3 |MDM20 |NAT3 |PEP12 |PKH1 |PKH2 |RVS161 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Zhang M, et al. (2008) Deletion of yeast CWP genes enhances cell permeability to genotoxic agents. Toxicol Sci 103(1):68-76 | |CWP1 |CWP2 |PDR5 | ||||
| Mutants/Phenotypes | Burgis NE and Samson LD (2007) The Protein Degradation Response of Saccharomyces cerevisiae to Classical DNA-Damaging Agents. Chem Res Toxicol 20(12):1843-53 | |MAG1 |MEC1 |PEP3 |RAD23 |RAD6 |RPN10 |RPN4 |UBI4 |VAM3 |YDJ1 | ||||
| Mutants/Phenotypes Strains/Constructs | Daicho K, et al. (2007) The ergosterol biosynthesis inhibitor zaragozic acid promotes vacuolar degradation of the tryptophan permease Tat2p in yeast. Biochim Biophys Acta 1768(7):1681-1690 | |ERG1 |ERG11 |ERG9 |PEP12 |PEP4 |RSP5 |TAT2 |VPS1 |VPS27 |VPS45 | ||||
| Mutants/Phenotypes | Fairn GD, et al. (2007) A chemogenomic screen in Saccharomyces cerevisiae uncovers a primary role for the mitochondria in farnesol toxicity and its regulation by the Pkc1 pathway. J Biol Chem 282(7):4868-74 | |AIM21 |ARG4 |BCK1 |CBP1 |CLA4 |COR1 |COX11 |DAL5 |ECM33 |EOS1 |FSF1 |FUI1 |FUR4 |FYV6 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Ito-Harashima S, et al. (2007) Translation of the poly(A) tail plays crucial roles in nonstop mRNA surveillance via translation repression and protein destabilization by proteasome in yeast. Genes Dev 21(5):519-24 | |||||
| Mutants/Phenotypes Strains/Constructs | Pagani MA, et al. (2007) Disruption of iron homeostasis in Saccharomyces cerevisiae by high zinc levels: a genome-wide study. Mol Microbiol 65(2):521-37 | |ACO1 |ACO2 |ADE1 |ADE12 |ADE13 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADK1 |AFT1 |AKR1 |ARN1 |MORE | ||||
| Reviews | Schulz TA and Prinz WA (2007) Sterol transport in yeast and the oxysterol binding protein homologue (OSH) family. Biochim Biophys Acta 1771(6):769-80 | |AUS1 |CAT5 |DAN1 |ERG1 |ERG11 |ERG27 |ERG3 |ERG5 |ERG7 |HES1 |KES1 |MGM101 |NCR1 |NPC2 |MORE | ||||
| Genetic Interactions Strains/Constructs | Shah Alam Bhuiyan M, et al. (2007) Synthetically lethal interactions involving loss of the yeast ERG24: the sterol C-14 reductase gene. Lipids 42(1):69-76 | |ERG2 |ERG24 |ERG28 |ERG3 |SUR4 | ||||
| Large-scale phenotype analysis | Yadav J, et al. (2007) A phenomics approach in yeast links proton and calcium pump function in the Golgi. Mol Biol Cell 18(4):1480-9 | |CUP5 |ERG2 |ERG3 |ERG4 |GAL11 |GCN4 |GCN5 |HFI1 |NHP10 |OPI1 |PMR1 |RPN4 |SAC1 |SET3 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Das-Bradoo S, et al. (2006) Interaction between PCNA and diubiquitinated Mcm10 is essential for cell growth in budding yeast. Mol Cell Biol 26(13):4806-17 | |MCM10 |POL1 |POL30 | ||||
| Mutants/Phenotypes Techniques and Reagents | Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109 | |ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Grossmann G, et al. (2006) Lipid raft-based membrane compartmentation of a plant transport protein expressed in Saccharomyces cerevisiae. Eukaryot Cell 5(6):945-53 | |||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Okamoto M, et al. (2006) Glycosylphosphatidylinositol-anchored proteins are required for the transport of detergent-resistant microdomain-associated membrane proteins Tat2p and Fur4p. J Biol Chem 281(7):4013-23 | |BUL1 |EAF3 |FUR4 |GWT1 |SSB1 |TAT2 |UBP5 |YDR266C | ||||
| Mutants/Phenotypes | Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401 | |AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE | ||||
| Cellular Location | Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54 | |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Sharma SC (2006) Implications of sterol structure for membrane lipid composition, fluidity and phospholipid asymmetry in Saccharomyces cerevisiae. FEMS Yeast Res 6(7):1047-51 | |ERG2 |ERG3 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Shobayashi M, et al. (2006) A new method for isolation of S-adenosylmethionine (SAM)-accumulating yeast. Appl Microbiol Biotechnol 69(6):704-10 | |ERG4 | ||||
| Mutants/Phenotypes Strains/Constructs | Simons V, et al. (2006) Dual effects of plant steroidal alkaloids on Saccharomyces cerevisiae. Antimicrob Agents Chemother 50(8):2732-40 | |ERG2 |ERG3 | ||||
| Protein Processing/Modification/Regulation Techniques and Reagents | Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48 | |AAC1 |AAC3 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |MORE | ||||
| Genetic Interactions Mutants/Phenotypes | Valachovic M, et al. (2006) Cumulative mutations affecting sterol biosynthesis in the yeast Saccharomyces cerevisiae result in synthetic lethality that is suppressed by alterations in sphingolipid profiles. Genetics 173(4):1893-908 | |BCK2 |ECM22 |ERG2 |ERG28 |ERG4 |ERG5 |GDA1 |HAP1 |HDA3 |IES1 |RDN25-1 |RDN37-1 |RPN9 |SSN2 |MORE | ||||
| Transcription | Warringer J and Blomberg A (2006) Involvement of yeast YOL151W/GRE2 in ergosterol metabolism. Yeast 23(5):389-98 | |BGL2 |ENO1 |ERG10 |ERG11 |ERG2 |ERG24 |GRE2 |HMG1 |HMG2 |HXK1 |MVD1 |RNR4 |TDH1 | ||||
| Cellular Location | Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50 | |AFG1 |AIM18 |ALD4 |ALO1 |ATP15 |ATP2 |ATP3 |ATP5 |AYR1 |BNA4 |CBR1 |CIR1 |COR1 |CYB2 |MORE | ||||
| Non-Fungal Related Genes/Proteins | Zhou W, et al. (2006) Mechanistic analysis of a multiple product sterol methyltransferase implicated in ergosterol biosynthesis in Trypanosoma brucei. J Biol Chem 281(10):6290-6 | |||||
| Mutants/Phenotypes | van Voorst F, et al. (2006) Genome-wide identification of genes required for growth of Saccharomyces cerevisiae under ethanol stress. Yeast 23(5):351-9 | |ASR1 |ATP1 |BEM2 |FAB1 |FEN1 |GCN5 |GIM4 |GIM5 |HMI1 |IMG1 |KAR3 |MSK1 |MSN2 |MTF2 |MORE | ||||
| Infection and Antifungals Mutants/Phenotypes Strains/Constructs | Cowen LE and Lindquist S (2005) Hsp90 potentiates the rapid evolution of new traits: drug resistance in diverse fungi. Science 309(5744):2185-9 | |CKA2 |CNA1 |CNB1 |CPR1 |ERG3 |HSC82 |LCL1 |PDR1 |PDR5 |RTC2 |SCS2 |YGR283C |YLR407W |YMR099C |MORE | ||||
| Reviews | Henneberry AL and Sturley SL (2005) Sterol homeostasis in the budding yeast, Saccharomyces cerevisiae. Semin Cell Dev Biol 16(2):155-61 | |NCR1 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Kishimoto T, et al. (2005) Defects in structural integrity of ergosterol and the Cdc50p-Drs2p putative phospholipid translocase cause accumulation of endocytic membranes, onto which actin patches are assembled in yeast. Mol Biol Cell 16(12):5592-609 | |ABP1 |ACT1 |BNI1 |CDC42 |CDC50 |DRS2 |ERG2 |ERG3 |ERG4 |ERG5 |GIC1 |LAS17 |SLA2 |SNC1 | ||||
| RNA Levels and Processing Regulation of | Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91 | |AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Liu Z, et al. (2005) A novel degron-mediated degradation of the RTG pathway regulator, Mks1p, by SCFGrr1. Mol Biol Cell 16(10):4893-904 | |BMH1 |GRR1 |MKS1 |RTG2 | ||||
| Protein-protein Interactions Techniques and Reagents | Mo C and Bard M (2005) A systematic study of yeast sterol biosynthetic protein-protein interactions using the split-ubiquitin system. Biochim Biophys Acta 1737(2-3):152-60 | |ERG1 |ERG11 |ERG2 |ERG24 |ERG25 |ERG26 |ERG27 |ERG28 |ERG3 |ERG4 |ERG5 |ERG7 |ERG9 | ||||
| Protein-protein Interactions | Mo C and Bard M (2005) Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex. J Lipid Res 46(9):1991-8 | |ERG1 |ERG11 |ERG25 |ERG26 |ERG27 |ERG28 | ||||
| Mutants/Phenotypes | Ott RG, et al. (2005) Flux of sterol intermediates in a yeast strain deleted of the lanosterol C-14 demethylase Erg11p. Biochim Biophys Acta 1735(2):111-8 | |ERG11 |ERG3 |ERG7 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Proszynski TJ, et al. (2005) A genome-wide visual screen reveals a role for sphingolipids and ergosterol in cell surface delivery in yeast. Proc Natl Acad Sci U S A 102(50):17981-6 | |AYR1 |BUD27 |CCZ1 |CHS5 |ERG4 |FAB1 |GIM3 |KES1 |LCB1 |MCH5 |MON1 |OPI9 |PAC10 |RVS161 |MORE | ||||
| Mutants/Phenotypes | Sano T, et al. (2005) Regulation of the sphingoid long-chain base kinase Lcb4p by ergosterol and heme: studies in phytosphingosine-resistant mutants. J Biol Chem 280(44):36674-82 | |DPL1 |ERG2 |ERG3 |ERG4 |ERG5 |HAP1 |HEM14 |HMG1 |KES1 |LCB3 |LCB4 |PBP1 |PDR5 |TPS1 |MORE | ||||
| RNA Levels and Processing | Shobayashi M, et al. (2005) Effects of Culture Conditions on Ergosterol Biosynthesis by Saccharomyces cerevisiae. Biosci Biotechnol Biochem 69(12):2381-8 | |ERG13 |ERG2 |ERG20 |ERG24 |ERG26 |ERG28 |ERG3 |ERG5 |HMG1 | ||||
| Mutants/Phenotypes Strains/Constructs Techniques and Reagents | Walsh L, et al. (2005) Genetic modification and variations in solvent increase the sensitivity of the yeast RAD54-GFP genotoxicity assay. Mutagenesis 20(5):317-27 | |PDR5 |RAD54 |SNQ2 |YOR1 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Branco MR, et al. (2004) Decrease of H2O2 plasma membrane permeability during adaptation to H2O2 in Saccharomyces cerevisiae. J Biol Chem 279(8):6501-6 | |CCP1 |CTT1 |ERG3 | ||||
| Mutants/Phenotypes Strains/Constructs | Chang HJ, et al. (2004) Role of the unfolded protein response pathway in secretory stress and regulation of INO1 expression in Saccharomyces cerevisiae. Genetics 168(4):1899-913 | |HAC1 |INO1 |IRE1 | ||||
| RNA Levels and Processing Regulation of | Jones DL, et al. (2004) Genome-Wide Analysis of the Effects of Heat Shock on a Saccharomyces cerevisiae Mutant With a Constitutively Activated cAMP-Dependent Pathway. Comp Funct Genomics 5(5):419-31 | |BTN2 |COX6 |DCS1 |ENO1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG26 |ERG27 |ERG3 |MORE | ||||
| RNA Levels and Processing Techniques and Reagents | Krantz M, et al. (2004) Anaerobicity prepares Saccharomyces cerevisiae cells for faster adaptation to osmotic shock. Eukaryot Cell 3(6):1381-90 | |ALD2 |ALD3 |ALD4 |ALD6 |CTT1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |MORE | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Markovich S, et al. (2004) Genomic approach to identification of mutations affecting caspofungin susceptibility in Saccharomyces cerevisiae. Antimicrob Agents Chemother 48(10):3871-6 | |BCK1 |CCR4 |CHC1 |CHS3 |CHS7 |CKA2 |CSG2 |ERG3 |ERG5 |FKS1 |ILM1 |MID2 |MNN10 |NPL3 |MORE | ||||
| Function/Process Protein-protein Interactions Strains/Constructs | Mo C, et al. (2004) The ERG28-encoded protein, Erg28p, interacts with both the sterol C-4 demethylation enzyme complex as well as the late biosynthetic protein, the C-24 sterol methyltransferase (Erg6p). Biochim Biophys Acta 1686(1-2):30-6 | |ERG11 |ERG28 |ERG3 |ERG7 | ||||
| Cellular Location Mutants/Phenotypes Protein Sequence Features Strains/Constructs | Mullner H, et al. (2004) Targeting of proteins involved in sterol biosynthesis to lipid particles of the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1663(1-2):9-13 | |ERG1 |ERG7 | ||||
| Mutants/Phenotypes | Pannunzio VG, et al. (2004) A Simple Chemical Method for Rendering Wild-Type Yeast Permeable to Brefeldin A That Does Not Require the Presence of an erg6 Mutation. J Biomed Biotechnol 2004(3):150-155 | |||||
| Genomic expression study RNA Levels and Processing Regulation of | Parveen M, et al. (2004) Response of Saccharomyces cerevisiae to a monoterpene: evaluation of antifungal potential by DNA microarray analysis. J Antimicrob Chemother 54(1):46-55 | |AAD6 |ADH5 |ADH7 |ADY2 |AGA2 |AMS1 |ARG1 |ARN2 |ATF2 |ATX1 |BCK1 |BFR1 |BSC1 |BUD7 |MORE | ||||
| Cross-species Expression Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs | Pourshafie M, et al. (2004) Cloning of S-adenosyl-L-methionine:C-24-Delta-sterol-methyltransferase (ERG6) from Leishmania donovani and characterization of mRNAs in wild-type and amphotericin B-Resistant promastigotes. Antimicrob Agents Chemother 48(7):2409-14 | |||||
| Mutants/Phenotypes | Serrano R, et al. (2004) Copper and iron are the limiting factors for growth of the yeast Saccharomyces cerevisiae in an alkaline environment. J Biol Chem 279(19):19698-704 | |AFT1 |ATX1 |BEM1 |BSD2 |BUD25 |CCC2 |CCS1 |COX17 |CTR1 |CUP5 |DIA2 |ERG2 |FET3 |FET4 |MORE | ||||
| Cellular Location Genetic Interactions | Sorger D, et al. (2004) A yeast strain lacking lipid particles bears a defect in ergosterol formation. J Biol Chem 279(30):31190-6 | |ARE1 |ARE2 |AYR1 |DGA1 |ERG1 |ERG7 |LRO1 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Tedrick K, et al. (2004) Enhanced membrane fusion in sterol-enriched vacuoles bypasses the Vrp1p requirement. Mol Biol Cell 15(10):4609-21 | |ACT1 |ARC35 |HUL4 |LAS17 |MIG1 |MKK1 |RRN5 |TOS2 |VAM3 |VPS33 |VPS5 |VRP1 |YPT7 | ||||
| Regulation of Transcription | Agarwal AK, et al. (2003) Genome-wide expression profiling of the response to polyene, pyrimidine, azole, and echinocandin antifungal agents in Saccharomyces cerevisiae. J Biol Chem 278(37):34998-5015 | |AGA1 |AMS1 |ATF2 |AUS1 |BAG7 |BAP2 |BAP3 |CRH1 |CTR1 |CWP1 |CYB5 |DAN1 |DAN4 |ELO1 |MORE | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Anderson JB, et al. (2003) Mode of selection and experimental evolution of antifungal drug resistance in Saccharomyces cerevisiae. Genetics 163(4):1287-98 | |CKA2 |ERG11 |ERG28 |ERG3 |LCL1 |PDR1 |PDR5 |RTC2 |SCS2 |SML1 |SNQ2 |SWH1 |YGR283C |YLR407W |MORE | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs Techniques and Reagents | Clark DD and Peterson BR (2003) Analysis of protein tyrosine kinase inhibitors in recombinant yeast lacking the ERG6 gene. Chembiochem 4(1):101-7 | |||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Gupta SS, et al. (2003) Antifungal activity of amiodarone is mediated by disruption of calcium homeostasis. J Biol Chem 278(31):28831-9 | |CCH1 |CUP5 |ERG24 |ERG3 |MID1 |PDR5 |PMC1 |PMR1 |PTC1 |RCY1 |SSC1 |VCX1 |VPS45 |YPK1 |MORE | ||||
| Cellular Location | Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12 | |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Umebayashi K and Nakano A (2003) Ergosterol is required for targeting of tryptophan permease to the yeast plasma membrane. J Cell Biol 161(6):1117-31 | |TAT2 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Valdez-Taubas J and Pelham HR (2003) Slow diffusion of proteins in the yeast plasma membrane allows polarity to be maintained by endocytic cycling. Curr Biol 13(18):1636-40 | |ACT1 |SNC1 |SSO1 |YBR016W | ||||
| Fungal Related Genes/Proteins | Young LY, et al. (2003) Disruption of ergosterol biosynthesis confers resistance to amphotericin B in Candida lusitaniae. Antimicrob Agents Chemother 47(9):2717-24 | |ERG3 | ||||
| Regulation of Transcription | Zhang W, et al. (2003) Microarray analyses of the metabolic responses of Saccharomyces cerevisiae to organic solvent dimethyl sulfoxide. J Ind Microbiol Biotechnol 30(1):57-69 | |AAH1 |ABP140 |ACS2 |ADE1 |ADE12 |ADE17 |ADE4 |ADE8 |ADH2 |ADH4 |ADH5 |ADK1 |ADO1 |ALD3 |MORE | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Bagnat M and Simons K (2002) Cell surface polarization during yeast mating. Proc Natl Acad Sci U S A 99(22):14183-8 | |BUL1 |BUL2 |FIG1 |FUS1 |FUS2 |GAP1 |HXT2 |LCB1 |LCB3 |PRM1 |SHO1 |STE6 |TRE1 | ||||
| Mutants/Phenotypes Strains/Constructs | Desmoucelles C, et al. (2002) Screening the yeast "disruptome" for mutants affecting resistance to the immunosuppressive drug, mycophenolic acid. J Biol Chem 277(30):27036-44 | |ANP1 |BUD30 |CTK1 |CTK3 |DAL81 |DST1 |ERG24 |ERG3 |ERG4 |ERG5 |GCN5 |HOM2 |HPR1 |HTZ1 |MORE | ||||
| Function/Process Mutants/Phenotypes | Dimmer KS, et al. (2002) Genetic basis of mitochondrial function and morphology in Saccharomyces cerevisiae. Mol Biol Cell 13(3):847-53 | |ABF2 |ACO1 |ADA2 |ADK1 |AEP1 |AEP2 |AEP3 |AFG3 |AFT1 |AIM10 |AIM22 |ALY1 |APQ13 |ARG82 |MORE | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Eisenkolb M, et al. (2002) A specific structural requirement for ergosterol in long-chain fatty acid synthesis mutants important for maintaining raft domains in yeast. Mol Biol Cell 13(12):4414-28 | |GAS1 |PMA1 |SUR4 | ||||
| Function/Process | Emter R, et al. (2002) ERG6 and PDR5 regulate small lipophilic drug accumulation in yeast cells via distinct mechanisms. FEBS Lett 521(1-3):57-61 | |PDR5 | ||||
| Function/Process Regulation of Transcription | Hongay C, et al. (2002) Mot3 is a transcriptional repressor of ergosterol biosynthetic genes and is required for normal vacuolar function in Saccharomyces cerevisiae. EMBO J 21(15):4114-24 | |ERG2 |ERG9 |MOT3 |PAN1 |VPS41 | ||||
| Mutants/Phenotypes Strains/Constructs | Marin S, et al. (2002) Promoter-specific inhibition of transcription by daunorubicin in Saccharomyces cerevisiae. Biochem J 368(Pt 1):131-6 | |GAL4 |PDR1 |PDR3 |PDR5 | ||||
| Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors | Nes WD, et al. (2002) Active site mapping and substrate channeling in the sterol methyltransferase pathway. J Biol Chem 277(45):42549-56 | |||||
| Function/Process Mutants/Phenotypes | Plowright AT, et al. (2002) Transcriptional response pathways in a yeast strain sensitive to saframycin a and a more potent analog: evidence for a common basis of activity. Chem Biol 9(5):607-18 | |PDR1 |PDR3 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Kato M and Wickner W (2001) Ergosterol is required for the Sec18/ATP-dependent priming step of homotypic vacuole fusion. EMBO J 20(15):4035-40 | |ERG3 |ERG4 |ERG5 |SEC17 |SEC18 | ||||
| Cellular Location Function/Process | Pichler H, et al. (2001) A subfraction of the yeast endoplasmic reticulum associates with the plasma membrane and has a high capacity to synthesize lipids. Eur J Biochem 268(8):2351-61 | |ERG1 |ERG9 | ||||
| Techniques and Reagents | Sato M, et al. (2001) Yeast Saccharomyces cerevisiae has two cis-prenyltransferases with different properties and localizations. Implication for their distinct physiological roles in dolichol synthesis. Genes Cells 6(6):495-506 | |RER2 |SRT1 | ||||
| Alias | Shieh HL, et al. (2001) Biochemical analysis of fructose-1,6-bisphosphatase import into vacuole import and degradation vesicles reveals a role for UBC1 in vesicle biogenesis. J Biol Chem 276(13):10398-406 | |FBP1 |RPL40A |RPL40B |RPS31 |UBC1 |UBI4 |VID24 | ||||
| Mutants/Phenotypes Strains/Constructs | Sievi E, et al. (2001) Proteolytic function of GPI-anchored plasma membrane protease Yps1p in the yeast vacuole and Golgi. Traffic 2(12):896-907 | |HSP150 |PEP4 |SEC7 |YPS1 | ||||
| Mutants/Phenotypes Strains/Constructs | Bammert GF and Fostel JM (2000) Genome-wide expression patterns in Saccharomyces cerevisiae: comparison of drug treatments and genetic alterations affecting biosynthesis of ergosterol. Antimicrob Agents Chemother 44(5):1255-65 | |ERG2 |ERG25 |ERG5 |RGI1 |TOS6 | ||||
| Mutants/Phenotypes Strains/Constructs | Inoue T, et al. (2000) Cloning and characterization of a gene complementing the mutation of an ethanol-sensitive mutant of sake yeast. Biosci Biotechnol Biochem 64(2):229-36 | |||||
| Reviews | Nes WD (2000) Sterol methyl transferase: enzymology and inhibition. Biochim Biophys Acta 1529(1-3):63-88 | |||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Sitcheran R, et al. (2000) A genetic analysis of glucocorticoid receptor signaling. Identification and characterization of ligand-effect modulators in Saccharomyces cerevisiae. Genetics 156(3):963-72 | |LEM3 |PDR5 | ||||
| Reviews | Sturley SL (2000) Conservation of eukaryotic sterol homeostasis: new insights from studies in budding yeast. Biochim Biophys Acta 1529(1-3):155-63 | |ARE1 |ARE2 |ARH1 |ARV1 |ECM22 |ERG10 |ERG11 |ERG9 |HMG1 |HMG2 |HMS1 |LRO1 |NCR1 |ROX1 |MORE | ||||
| Mutants/Phenotypes | Zweytick D, et al. (2000) Biochemical characterization and subcellular localization of the sterol C-24(28) reductase, erg4p, from the yeast saccharomyces cerevisiae. FEBS Lett 470(1):83-7 | |ERG4 | ||||
| Reviews | Zweytick D, et al. (2000) Intracellular lipid particles of eukaryotic cells. Biochim Biophys Acta 1469(2):101-20 | |AYR1 |EHT1 |ERG1 |ERG7 |FAA1 |FAA4 |FAT1 |NUS1 |PET10 |SLC1 |TDH1 |TDH2 |TDH3 |TGL1 |MORE | ||||
| Cellular Location | Athenstaedt K, et al. (1999) Identification and characterization of major lipid particle proteins of the yeast Saccharomyces cerevisiae. J Bacteriol 181(20):6441-8 | |EHT1 |ERG1 |ERG7 |FAA1 |FAA4 |FAT1 |NUS1 |PET10 |TGL1 |TGL3 |YJU3 |YOR059C | ||||
| Genomic expression study Regulation of | Dimster-Denk D, et al. (1999) Comprehensive evaluation of isoprenoid biosynthesis regulation in Saccharomyces cerevisiae utilizing the Genome Reporter Matrix. J Lipid Res 40(5):850-60 | |ARE1 |ARE2 |BEM1 |BET2 |BET4 |BTS1 |CAT5 |CDC43 |COQ1 |COQ2 |COQ3 |COQ6 |COX10 |ERG1 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Kaur R and Bachhawat AK (1999) The yeast multidrug resistance pump, Pdr5p, confers reduced drug resistance in erg mutants of Saccharomyces cerevisiae. Microbiology 145 ( Pt 4)():809-18 | |CHO1 |ERG2 |ERG3 |ERG4 |PDR5 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Munn AL, et al. (1999) Specific sterols required for the internalization step of endocytosis in yeast. Mol Biol Cell 10(11):3943-57 | |ERG2 | ||||
| Non-Fungal Related Genes/Proteins Protein Sequence Features | Niewmierzycka A and Clarke S (1999) S-Adenosylmethionine-dependent methylation in Saccharomyces cerevisiae. Identification of a novel protein arginine methyltransferase. J Biol Chem 274(2):814-24 | |ABD1 |ABP140 |BDH2 |BUD23 |COQ3 |COQ5 |COX1 |CRG1 |DIM1 |GCD14 |HMT1 |MET1 |MNI1 |MTQ2 |MORE | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Chabane S, et al. (1998) Over-expression of the yeast BFR2 gene partially suppresses the growth defects induced by Brefeldin A and by four ER-to-Golgi mutations. Curr Genet 33(1):21-8 | |BFR2 |SEC13 |SEC16 |SEC23 |YPT1 | ||||
| Reviews | Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510 | |ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE | ||||
| Genetic Interactions Strains/Constructs | Jensen-Pergakes KL, et al. (1998) Sequencing, disruption, and characterization of the Candida albicans sterol methyltransferase (ERG6) gene: drug susceptibility studies in erg6 mutants. Antimicrob Agents Chemother 42(5):1160-7 | |||||
| Cellular Location | Leber R, et al. (1998) Dual localization of squalene epoxidase, Erg1p, in yeast reflects a relationship between the endoplasmic reticulum and lipid particles. Mol Biol Cell 9(2):375-86 | |ERG1 |KAR2 | ||||
| Function/Process Protein Physical Properties Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs Techniques and Reagents | Nes WD, et al. (1998) Overexpression, purification, and stereochemical studies of the recombinant (S)-adenosyl-L-methionine: delta 24(25)- to delta 24(28)-sterol methyl transferase enzyme from Saccharomyces cerevisiae. Arch Biochem Biophys 353(2):297-311 | |||||
| Function/Process Substrates/Ligands/Cofactors | Acuna-Johnson AP, et al. (1997) Stereochemistry of yeast delta 24-sterol methyl transferase. Bioorg Med Chem 5(5):821-32 | |||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Gachotte D, et al. (1997) A yeast sterol auxotroph (erg25) is rescued by addition of azole antifungals and reduced levels of heme. Proc Natl Acad Sci U S A 94(21):11173-8 | |ERG11 |ERG25 |HEM2 |HEM4 | ||||
| Cross-species Expression Non-Fungal Related Genes/Proteins Strains/Constructs | Grebenok RJ, et al. (1997) Characterization of Zea mays endosperm C-24 sterol methyltransferase: one of two types of sterol methyltransferase in higher plants. Plant Mol Biol 34(6):891-6 | |||||
| Function/Process Protein Processing/Modification/Regulation Protein-protein Interactions | Nes WD, et al. (1997) Substrate-based inhibitors of the (S)-adenosyl-L-methionine:delta24(25)- to delta24(28)-sterol methyl transferase from Saccharomyces cerevisiae. Arch Biochem Biophys 342(1):68-81 | |||||
| Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs | Arthington-Skaggs BA, et al. (1996) Positive and negative regulation of a sterol biosynthetic gene (ERG3) in the post-squalene portion of the yeast ergosterol pathway. FEBS Lett 392(2):161-5 | |ARE1 |ARE2 |ERG2 |ERG3 |ERG4 |ERG5 | ||||
| Genetic Interactions | Fang M, et al. (1996) Kes1p shares homology with human oxysterol binding protein and participates in a novel regulatory pathway for yeast Golgi-derived transport vesicle biogenesis. EMBO J 15(23):6447-59 | |ERG3 |HES1 |HMG1 |HMG2 |KES1 |SEC14 |SWH1 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs | Hemenway CS and Heitman J (1996) Immunosuppressant target protein FKBP12 is required for P-glycoprotein function in yeast. J Biol Chem 271(31):18527-34 | |CNB1 |CPR1 |FPR1 |RAD52 |STE6 |VMA22 | ||||
| Alias Function/Process Mutants/Phenotypes Strains/Constructs | Hoffman M and Chiang HL (1996) Isolation of degradation-deficient mutants defective in the targeting of fructose-1,6-bisphosphatase into the vacuole for degradation in Saccharomyces cerevisiae. Genetics 143(4):1555-66 | |FBP1 | ||||
| Non-Fungal Related Genes/Proteins Strains/Constructs | Husselstein T, et al. (1996) Transformation of Saccharomyces cerevisiae with a cDNA encoding a sterol C-methyltransferase from Arabidopsis thaliana results in the synthesis of 24-ethyl sterols. FEBS Lett 381(1-2):87-92 | |||||
| Alias Function/Process Mutants/Phenotypes Strains/Constructs | Lee DH and Goldberg AL (1996) Selective inhibitors of the proteasome-dependent and vacuolar pathways of protein degradation in Saccharomyces cerevisiae. J Biol Chem 271(44):27280-4 | |||||
| Function/Process Protein Physical Properties Substrates/Ligands/Cofactors | Venkatramesh M, et al. (1996) Mechanism and structural requirements for transformation of substrates by the (S)-adenosyl-L-methionine:delta 24(25)-sterol methyl transferase from Saccharomyces cerevisiae. Biochim Biophys Acta 1299(3):313-24 | |ERG7 | ||||
| Regulation of Substrates/Ligands/Cofactors Techniques and Reagents | Venkatramesh M, et al. (1996) Sterol specificity of the Saccharomyces cerevisiae ERG6 gene product expressed in Escherichia coli. Lipids 31(4):373-7 | |||||
| Mutants/Phenotypes Strains/Constructs | Espinet C, et al. (1995) An efficient method to isolate yeast genes causing overexpression-mediated growth arrest. Yeast 11(1):25-32 | |ACT1 |AFT1 |ARF2 |ATE1 |AUA1 |HSF1 |MCM1 |NHP6A |NSR1 |NTH1 |RHO1 |SEC17 |SHE1 |SHE10 |MORE | ||||
| Reviews | Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6 | |ERG1 |ERG11 |ERG2 |ERG24 |ERG3 |ERG4 |ERG5 |ERG7 |ERG9 |FEN1 |FEN2 | ||||
| Reviews | Parks LW and Casey WM (1995) Physiological implications of sterol biosynthesis in yeast. Annu Rev Microbiol 49:95-116 | |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |ERG3 |ERG4 |ERG5 |ERG7 |ERG8 |MORE | ||||
| Reviews | Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30 | |ERG1 |ERG10 |ERG11 |ERG12 |ERG2 |ERG20 |ERG24 |ERG3 |ERG4 |ERG5 |ERG7 |ERG8 |ERG9 |HMG1 |MORE | ||||
| Cell Cycle Phase Involved Mutants/Phenotypes Strains/Constructs | Prendergast JA, et al. (1995) Mutations sensitizing yeast cells to the start inhibitor nalidixic acid. Yeast 11(6):537-47 | |ARO7 |ERG3 | ||||
| Mutants/Phenotypes Strains/Constructs Techniques and Reagents | Rambourg A, et al. (1995) Effects of brefeldin A on the three-dimensional structure of the Golgi apparatus in a sensitive strain of Saccharomyces cerevisiae. Anat Rec 241(1):1-9 | |ARF1 | ||||
| Alias Genetic Interactions Mapping Mutants/Phenotypes Protein Sequence Features | Hardwick KG and Pelham HR (1994) SED6 is identical to ERG6, and encodes a putative methyltransferase required for ergosterol synthesis. Yeast 10(2):265-9 | |ERD2 | ||||
| Cellular Location Mutants/Phenotypes Strains/Constructs Techniques and Reagents | Leber R, et al. (1994) Characterization of lipid particles of the yeast, Saccharomyces cerevisiae. Yeast 10(11):1421-8 | |||||
| Alias Mutants/Phenotypes Strains/Constructs | Welihinda AA, et al. (1994) Mutations in LIS1 (ERG6) gene confer increased sodium and lithium uptake in Saccharomyces cerevisiae. Biochim Biophys Acta 1193(1):107-17 | |||||
| Alias Mutants/Phenotypes Strains/Constructs | Graham TR, et al. (1993) Brefeldin A reversibly blocks early but not late protein transport steps in the yeast secretory pathway. EMBO J 12(3):869-77 | |PRC1 | ||||
| Mutants/Phenotypes Strains/Constructs | Shah N and Klausner RD (1993) Brefeldin A reversibly inhibits secretion in Saccharomyces cerevisiae. J Biol Chem 268(8):5345-8 | |||||
| Mutants/Phenotypes Strains/Constructs | Vogel JP, et al. (1993) Brefeldin A causes a defect in secretion in Saccharomyces cerevisiae. J Biol Chem 268(5):3040-3 | |||||
| Mutants/Phenotypes Strains/Constructs Techniques and Reagents | Heiderpriem RW, et al. (1992) A simple method for the isolation of zymosterol from a sterol mutant of Saccharomyces cerevisiae. J Steroid Biochem Mol Biol 43(7):741-3 | |ERG2 | ||||
| Reviews | Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press | |ACC1 |ACH1 |CDS1 |CHO1 |CHO2 |CKI1 |CTR1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |MORE | ||||
| Cell Cycle Phase Involved Function/Process Mapping Mutants/Phenotypes Strains/Constructs | Gaber RF, et al. (1989) The yeast gene ERG6 is required for normal membrane function but is not essential for biosynthesis of the cell-cycle-sparking sterol. Mol Cell Biol 9(8):3447-56 | |SEC59 | ||||
| Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors | Lorenz RT, et al. (1989) Structural discrimination in the sparking function of sterols in the yeast Saccharomyces cerevisiae. J Bacteriol 171(11):6169-73 | |ERG7 |HEM1 | ||||
| Mutants/Phenotypes Strains/Constructs Techniques and Reagents | Xu SH and Nes WD (1988) Biosynthesis of cholesterol in the yeast mutant erg6. Biochem Biophys Res Commun 155(1):509-17 | |||||
| Cell Cycle Phase Involved Cellular Location Mapping Mutants/Phenotypes Strains/Constructs Techniques and Reagents | McCammon MT, et al. (1984) Sterol methylation in Saccharomyces cerevisiae. J Bacteriol 157(2):475-83 | |ERG3 | ||||
| Function/Process Protein Processing/Modification/Regulation Substrates/Ligands/Cofactors | Oehlschlager AC, et al. (1984) Azasterol inhibition of delta 24-sterol methyltransferase in Saccharomyces cerevisiae. Biochemistry 23(16):3582-9 | |||||
| Function/Process Protein Physical Properties Substrates/Ligands/Cofactors | Hata S, et al. (1982) Effect of detergents on sterol synthesis in a cell-free system of yeast. J Lipid Res 23(6):803-10 | |ERG1 |ERG9 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents | Kleinhans FW, et al. (1979) ESR determinations of membrane permeability in a yeast sterol mutant. Chem Phys Lipids 23(2):143-54 | |ERG2 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors | Lees ND, et al. (1979) ESR determination of membrane order parameter in yeast sterol mutants. Biochim Biophys Acta 553(3):469-75 | |ERG2 | ||||
| Function/Process | Pierce AM, et al. (1979) Azasterol inhibitors in yeast. Inhibition of the delta 24-sterol methyltransferase and the 24-methylene sterol delta 24(28)-reductase in sterol mutants of Saccharomyces cerevisiae. Can J Biochem 57(3):201-8 | |ERG2 |ERG5 | ||||
| Regulation of | Parks LW, et al. (1978) Sterols in yeast subcellular fractions. Lipids 13(10):730-5 | |ERG24 |ERG4 | ||||
| Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs | Pierce AM, et al. (1978) Metabolism of delta24-sterols by yeast mutants blocked in removal of the C-14 methyl group. Can J Biochem 56(8):794-800 | |||||
| Function/Process Protein Processing/Modification/Regulation | Pierce HD Jr, et al. (1978) Azasterol inhibitors in yeast. Inhibition of the 24-methylene sterol delta24(28)-reductase and delta24-sterol methyltransferase of Saccharomyces cerevisiae by 23-azacholesterol. Biochim Biophys Acta 529(3):429-37 | |ERG4 | ||||
| Mutants/Phenotypes Strains/Constructs Techniques and Reagents | Bard M, et al. (1977) Sterol mutants of Saccharomyces cerevisiae: chromatographic analyses. Lipids 12(8):645-54 | |ERG2 |ERG3 |ERG5 | ||||
| Function/Process | Bailey RB, et al. (1976) Homoazasterol-mediated inhibition of yeast sterol biosynthesis. J Bacteriol 128(3):730-4 | |||||
| Cellular Location Function/Process Protein Processing/Modification/Regulation Substrates/Ligands/Cofactors | Bailey RB and Parks LW (1975) Potassium translocation in yeast mitochondria and its relationship to ergostrol biosynthesis. J Bacteriol 122(2):606-9 | |||||
| Regulation of Substrates/Ligands/Cofactors | Moore JT Jr and Gaylor JL (1970) Investigation of an S-adenosylmethionine: delta 24-sterol methyltransferase in ergosterol biosynthesis in yeast. Specificity of sterol substrates and inhibitors. J Biol Chem 245(18):4684-8 | |||||
| Alias Function/Process Protein Physical Properties Substrates/Ligands/Cofactors | Moore JT and Gaylor JL (1969) Isolation and purification of an S-adenosylmethionine: delta 24-sterol methyltransferase from yeast. J Biol Chem 244(23):6334-40 | |||||
Return to SGD |