---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP2/YLR335W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXII: 797430 to 799592 CDS: 797430 - 799592 Genetic Map Data Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP2	YLR335W		ORF, Verified	S000004327
Description
Nucleoporin involved in nucleocytoplasmic transport, binds to either the nucleoplasmic or cytoplasmic faces of the nuclear pore complex depending on Ran-GTP levels; also has a role in chromatin organization

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD chromatin silencing at telomere Dilworth DJ, et al. (2005) The mobile nucleoporin Nup2p and chromatin-bound Prp20p function in endogenous NPC-mediated transcriptional control. J Cell Biol 171(6):955-65        IMP : Inferred from Mutant Phenotype Assigned on 2006-02-10 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT intracellular transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000156 Assigned on 2007-05-23 UniProtKB mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear-transcribed mRNA catabolic process, non-stop decay Wilson MA, et al. (2007) A genomic screen in yeast reveals novel aspects of nonstop mRNA metabolism. Genetics 177(2):773-84        IMP : Inferred from Mutant Phenotype Assigned on 2009-03-06 SGD protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein targeting to membrane King MC, et al. (2006) Karyopherin-mediated import of integral inner nuclear membrane proteins. Nature 442(7106):1003-7      IMP : Inferred from Mutant Phenotype Assigned on 2007-10-02 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12          IDA : Inferred from Direct Assay Assigned on 2004-09-28 SGD Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD nuclear chromatin Dilworth DJ, et al. (2005) The mobile nucleoporin Nup2p and chromatin-bound Prp20p function in endogenous NPC-mediated transcriptional control. J Cell Biol 171(6):955-65        IDA : Inferred from Direct Assay Assigned on 2006-02-10 SGD nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP2/YLR335W for NUP2 NUP2 encodes a non-essential nuclear pore protein that has a central domain similar to those of Nsp1p and Nup1p (1, 2, 3). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 2, 3, 4, 5). The structure of the vertebrate NPC has been studied extensively; recent reviews include 6, 7, 8, and 9. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (10, 11). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 2, 3, 12, 13, 14). nup2 mutants show genetic interactions with nsp1 and nup1 conditional alleles (1, 2, 3). Nup1p interacts with the nuclear import factor Srp1p (15) and with the small GTPase Ran (encoded by GSP1) (16). Last Updated: 1999-07-18

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP2/YLR335W for NUP2 1) Loeb JD, et al. (1993) NUP2, a novel yeast nucleoporin, has functional overlap with other proteins of the nuclear pore complex. Mol Biol Cell 4(2):209-22      2) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      3) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    4) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      5) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      6) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      7) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      8) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      9) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      10) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      11) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        12) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      13) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        14) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      15) Belanger KD, et al. (1994) Genetic and physical interactions between Srp1p and nuclear pore complex proteins Nup1p and Nup2p. J Cell Biol 126(3):619-30      16) Dingwall C, et al. (1995) A family of Ran binding proteins that includes nucleoporins. Proc Natl Acad Sci U S A 92(16):7525-9        17) Hood JK, et al. (2000) Nup2p is located on the nuclear side of the nuclear pore complex and coordinates Srp1p/importin-alpha export. J Cell Sci 113 ( Pt 8):1471-80        18) Solsbacher J, et al. (2000) Nup2p, a yeast nucleoporin, functions in bidirectional transport of importin alpha. Mol Cell Biol 20(22):8468-79        19) Ishii K, et al. (2002) Chromatin boundaries in budding yeast: the nuclear pore connection. Cell 109(5):551-62        20) Dilworth DJ, et al. (2001) Nup2p dynamically associates with the distal regions of the yeast nuclear pore complex. J Cell Biol 153(7):1465-78

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP2/YLR335W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP2/YLR335W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MAKRVAD C-term DAKKEMK Length(aa) 720 MW(Da) 77,880 pI 7.34 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.050   Codon Adaptation Index 0.143   Frequency of Optimal Codons 0.440   Hydropathicity of Protein -0.904   Aromaticity Score 0.071

10 20 30 40 50 | | | | | MAKRVADAQIQRETYDSNESDDDVTPSTKVASSAVMNRRKIAMPKRRMAF KPFGSAKSDETKQASSFSFLNRADGTGEAQVDNSPTTESNSRLKALNLQF KAKVDDLVLGKPLADLRPLFTRYELYIKNILEAPVKSIENPTQTKGNDAK PAKVEDVQKSSDSSSEDEVKVEGPKFTIDAKPPISDSVFSFGPKKENRKK DESDSENDIEIKGPEFKFSGTVSSDVFKLNPSTDKNEKKTETNAKPFSFS SATSTTEQTKSKNPLSLTEATKTNVDNNSKAEASFTFGTKHAADSQNNKP SFVFGQAAAKPSLEKSSFTFGSTTIEKKNDENSTSNSKPEKSSDSNDSNP SFSFSIPSKNTPDASKPSFSFGVPNSSKNETSKPVFSFGAATPSAKEASQ EDDNNNVEKPSSKPAFNLISNAGTEKEKESKKDSKPAFSFGISNGSESKD SDKPSLPSAVDGENDKKEATKPAFSFGINTNTTKTADTKAPTFTFGSSAL ADNKEDVKKPFSFGTSQPNNTPSFSFGKTTANLPANSSTSPAPSIPSTGF KFSLPFEQKGSQTTTNDSKEESTTEATGNESQDATKVDATPEESKPINLQ NGEEDEVALFSQKAKLMTFNAETKSYDSRGVGEMKLLKKKDDPSKVRLLC RSDGMGNVLLNATVVDSFKYEPLAPGNDNLIKAPTVAADGKLVTYIVKFK QKEEGRSFTKAIEDAKKEMK*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP2/YLR335W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to NUP2 Homolog Source (per PDB) Protein Alignment: NUP2 vs. Homolog External Links P-Value %Identical %Similar Alignment 1un0 ( Chain: C, D) Crystal structure of yeast karyopherin (importin) alpha in complex with a nup2p n-terminal fragment PDB_Info PDB_Structure Saccharomyces cerevisiae Chain C = 1.9e-14 100 0 View alignment SCOP MMDB CATH Chain D = 1.9e-14 100 0 View alignment 2c1t ( Chain: C, D) Structure of the kap60p:nup2 complex PDB_Info PDB_Structure Saccharomyces cerevisiae Chain C = 1.9e-14 100 0 View alignment SCOP MMDB CATH Chain D = 1.9e-14 100 0 View alignment 1o6o ( Chain: E, F, D) Importin beta aa1-442 bound to five fxfg repeats from yeast nsp1p. second crystal form PDB_Info PDB_Structure Homo sapiens | Saccharomyces cerevisiae Chain E = 2.2e-06 36 33 View alignment SCOP MMDB CATH Chain F = 2.2e-06 36 33 View alignment Chain D = 2.2e-06 36 33 View alignment 1xke ( Chain: A) Solution structure of the second ran-binding domain from human ranbp2 PDB_Info PDB_Structure Homo sapiens 4.6e-06 31 37 View alignment SCOP MMDB CATH 1rrp ( Chain: D, B) Structure of the ran-gppnhp-ranbd1 complex PDB_Info PDB_Structure Homo sapiens Chain D = 6.4e-06 31 32 View alignment SCOP MMDB CATH Chain B = 6.4e-06 31 32 View alignment 1k5d ( Chain: E, B, H, K) Crystal structure of ran-gppnhp-ranbp1-rangap complex PDB_Info PDB_Structure Homo sapiens | Schizosaccharomyces pombe Chain E = 0.000479 29 31 View alignment SCOP MMDB CATH Chain B = 0.000479 29 31 View alignment Chain H = 0.000479 29 31 View alignment Chain K = 0.000479 29 31 View alignment 1k5g ( Chain: H, K, B, E) Crystal structure of ran-gdp-alfx-ranbp1-rangap complex PDB_Info PDB_Structure Homo sapiens | Schizosaccharomyces pombe Chain H = 0.000479 29 31 View alignment SCOP MMDB CATH Chain K = 0.000479 29 31 View alignment Chain B = 0.000479 29 31 View alignment Chain E = 0.000479 29 31 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP2	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YLR335W	SGD Systematic Sequence
851048	NCBI: Gene ID
NP_013439.1	NCBI: RefSeq protein version ID
NP_013439.1	NCBI: RefSeq protein version ID
6323367	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
74 curated references; 0 references not yet curated
Function/Process Mutants/Phenotypes Strains/Constructs	Ahmed S, et al. (2010) DNA zip codes control an ancient mechanism for gene targeting to the nuclear periphery. Nat Cell Biol 12(2):111-8	|GLE2 |INO1 |MLP2 |NUP1 |NUP157 |NUP60 |SAC3 |SUS1 |THP1 |TSA2
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NIC96 |NMD5 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP159 |MORE
Evolution Non-Fungal Related Genes/Proteins	DeGrasse JA, et al. (2009) Evidence for a shared nuclear pore complex architecture that is conserved from the last common eukaryotic ancestor. Mol Cell Proteomics 8(9):2119-30	|MLP1 |MLP2 |NIC96 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |NUP82 |NUP84 |NUP85
Cellular Location Strains/Constructs	Flemming D, et al. (2009) Two structurally distinct domains of the nucleoporin Nup170 cooperate to tether a subset of nucleoporins to nuclear pores. J Cell Biol 185(3):387-95	|NUP1 |NUP157 |NUP159 |NUP170 |NUP188 |NUP82 |POM152 |POM34
Mutants/Phenotypes Strains/Constructs	Kim TY, et al. (2009) Differential subcellular localization of ribosomal protein L7 paralogs in Saccharomyces cerevisiae. Mol Cells 27(5):539-46	|CGR1 |LOC1 |LOS1 |NSR1 |NUP170 |RPL7A |RPL7B |SLX9
Cellular Location Regulation of	Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73	|APQ12 |ASM4 |GLE1 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP1 |NUP100 |NUP133 |NUP157 |NUP159 |MORE
Cellular Location Strains/Constructs	Onischenko E, et al. (2009) Role of the Ndc1 interaction network in yeast nuclear pore complex assembly and maintenance. J Cell Biol 185(3):475-91	|ASM4 |MPS3 |NDC1 |NPL3 |NUP133 |NUP157 |NUP170 |NUP188 |NUP53 |NUP82 |POM152 |POM34
Genetic Interactions Mutants/Phenotypes	Pulliam KF, et al. (2009) The Classical Nuclear Localization Signal Receptor, Importin-{alpha}, Is Required for Efficient Transition Through the G1/S Stage of the Cell Cycle in Saccharomyces cerevisiae. Genetics 181(1):105-18	|CDC45 |CSE1 |MCM10 |SRP1 |YOX1
Genetic Interactions	Bennett CB, et al. (2008) Yeast Screens Identify the RNA Polymerase II CTD and SPT5 as Relevant Targets of BRCA1 Interaction. PLoS ONE 3(1):e1448	|APT1 |ASM4 |ATE1 |BBC1 |BEM4 |BUR2 |CCR4 |CTK1 |DAN1 |DEF1 |DHH1 |GYP5 |HDA3 |MET18 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Hahn S, et al. (2008) Classical NLS proteins from Saccharomyces cerevisiae. J Mol Biol 379(4):678-94	|CDC45 |CDC6 |CLB2 |KAP95 |SRM1 |SRP1 |SWI5
Protein Processing/Modification/Regulation	Shen Y, et al. (2008) Mass spectrometry analysis of proteome-wide proteolytic post-translational degradation of proteins. Anal Chem 80(15):5819-28	|ACT1 |BFR1 |COF1 |FBA1 |HSP10 |KAR2 |NSP1 |OM45 |PGK1 |PRE2 |PRE3 |PUP1 |RPL3 |SRV2 |MORE
Mutants/Phenotypes	Thomsen R, et al. (2008) General, rapid, and transcription-dependent fragmentation of nucleolar antigens in S. cerevisiae mRNA export mutants. RNA 14(4):706-16	|ASM4 |HPR1 |HSP104 |MEX67 |MFT1 |NOP1 |NOP58 |NSR1 |NUP100 |NUP120 |NUP133 |NUP159 |NUP188 |NUP42 |MORE
Reviews	Ahmed S and Brickner JH (2007) Regulation and epigenetic control of transcription at the nuclear periphery. Trends Genet 23(8):396-402	|ADA2 |CHD1 |GCN5 |HFI1 |HTZ1 |MEX67 |MLP1 |MLP2 |NGG1 |NUP60 |NUP84 |SAC3 |SGF11 |SGF29 |MORE
Evolution Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure	Denning DP and Rexach MF (2007) Rapid evolution exposes the boundaries of domain structure and function in natively unfolded FG nucleoporins. Mol Cell Proteomics 6(2):272-82	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP159 |NUP42 |NUP49 |NUP53 |NUP57 |NUP60
Reviews	Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73	|ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |MORE
Cellular Location Strains/Constructs	Lewis A, et al. (2007) A nuclear envelope protein linking nuclear pore basket assembly, SUMO protease regulation, and mRNA surveillance. J Cell Biol 178(5):813-27	|ESC1 |ESC2 |MLP1 |MLP2 |NUP49 |NUP60 |SIR4 |ULP1 |ULP2 |YKU80
Cellular Location	McGuire AT and Mangroo D (2007) Cex1p is a novel cytoplasmic component of the Saccharomyces cerevisiae nuclear tRNA export machinery. EMBO J 26(2):288-300	|ARC1 |CCA1 |CEX1 |GSP1 |LOS1 |MSN5 |NUP116 |NUP57 |TEF2
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96	|GLE1 |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP157 |NUP159 |NUP170 |NUP192 |MORE
Protein Processing/Modification/Regulation Regulation of	Smolka MB, et al. (2007) Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Proc Natl Acad Sci U S A 104(25):10364-9	|CEP3 |CPR5 |CTF4 |DEF1 |DUN1 |EXO1 |HPC2 |ITC1 |MEC1 |MLP1 |NET1 |NPL3 |NSP1 |NUP1 |MORE
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Terry LJ and Wente SR (2007) Nuclear mRNA export requires specific FG nucleoporins for translocation through the nuclear pore complex. J Cell Biol 178(7):1121-32	|KAP104 |MEX67 |NSP1 |NUP1 |NUP100 |NUP116 |NUP145 |NUP49 |NUP57 |NUP60 |PSE1
Function/Process Mutants/Phenotypes Strains/Constructs	Wilson MA, et al. (2007) A genomic screen in yeast reveals novel aspects of nonstop mRNA metabolism. Genetics 177(2):773-84	|HTZ1 |IPK1 |IRC25 |MED1 |PRE9 |RKR1 |SIR3 |SKI2 |SKI3 |SKI7 |SKI8 |SSN2 |SSN3 |UMP1 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Mutants/Phenotypes Techniques and Reagents	Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109	|ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Mutants/Phenotypes Regulatory Role Strains/Constructs	King MC, et al. (2006) Karyopherin-mediated import of integral inner nuclear membrane proteins. Nature 442(7106):1003-7	|HEH2 |KAP114 |KAP120 |KAP122 |KAP95 |NUP170 |PSE1 |SRC1 |SRP1
Cellular Location	Miao M, et al. (2006) The integral membrane protein pom34p functionally links nucleoporin subcomplexes. Genetics 172(3):1441-57	|ASM4 |GLE2 |NSP1 |NUP100 |NUP116 |NUP120 |NUP159 |NUP170 |NUP188 |NUP49 |NUP57 |NUP82 |POM152 |POM34 |MORE
Cellular Location	Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
DNA/RNA Sequence Features Function/Process Protein-Nucleic Acid Interactions Techniques and Reagents	Schmid M, et al. (2006) Nup-PI: the nucleopore-promoter interaction of genes in yeast. Mol Cell 21(3):379-91	|GAL1 |GAL10 |GAL4 |HTA1 |HTA2 |HXK1 |SPT15 |SPT20 |SUS1
Mutants/Phenotypes Strains/Constructs	Berger AC, et al. (2005) A yeast model system for functional analysis of the Niemann-Pick type C protein 1 homolog, Ncr1p. Traffic 6(10):907-17	|ATG20 |DRS2 |NCR1 |VPS4
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Dilworth DJ, et al. (2005) The mobile nucleoporin Nup2p and chromatin-bound Prp20p function in endogenous NPC-mediated transcriptional control. J Cell Biol 171(6):955-65	|HTZ1 |NUP60 |SRM1
Mutants/Phenotypes	Luna R, et al. (2005) Interdependence between transcription and mRNP processing and export, and its impact on genetic stability. Mol Cell 18(6):711-22	|BRR6 |CAF20 |CCR4 |CDC40 |CFT1 |CRM1 |DBP1 |DBP5 |DBP7 |DCP1 |FIP1 |GBP2 |GLE1 |HRB1 |MORE
Mutants/Phenotypes Strains/Constructs	Scott RJ, et al. (2005) Interactions between Mad1p and the nuclear transport machinery in the yeast Saccharomyces cerevisiae. Mol Biol Cell 16(9):4362-74	|KAP95 |MAD1 |MLP1 |MLP2 |NUP170 |NUP53 |NUP60 |POM34 |PSE1
Protein Processing/Modification/Regulation Protein Sequence Features Protein-protein Interactions	Smolka MB, et al. (2005) Dynamic changes in protein-protein interaction and protein phosphorylation probed with amine-reactive isotope tag. Mol Cell Proteomics 4(9):1358-69	|ASF1 |HHF1 |HHF2 |HTA1 |HTA2 |HTB1 |HTB2 |KAP95 |RAD53 |RAD9 |SRP1 |YTA7
Fungal Related Genes/Proteins	Chen XQ, et al. (2004) Identification of genes encoding putative nucleoporins and transport factors in the fission yeast Schizosaccharomyces pombe: a deletion analysis. Yeast 21(6):495-509	|CSE1 |MLP1 |NUP120 |NUP133 |NUP53 |NUP84 |NUP85
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |MORE
Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Gilchrist D and Rexach M (2003) Molecular basis for the rapid dissociation of nuclear localization signals from karyopherin alpha in the nucleoplasm. J Biol Chem 278(51):51937-49	|CSE1 |GSP1 |KAP95 |SRP1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Harreman MT, et al. (2003) Characterization of the auto-inhibitory sequence within the N-terminal domain of importin alpha. J Biol Chem 278(24):21361-9	|CSE1 |SRP1
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure	Matsuura Y, et al. (2003) Structural basis for Nup2p function in cargo release and karyopherin recycling in nuclear import. EMBO J 22(20):5358-69	|CSE1 |SRP1
Cellular Location	Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
Protein-protein Interactions	Allen NP, et al. (2002) Deciphering networks of protein interactions at the nuclear pore complex. Mol Cell Proteomics 1(12):930-46	|CRM1 |CSE1 |GSP1 |KAP95 |MEX67 |NUP100 |NUP116 |NUP120 |NUP133 |NUP159 |NUP49 |NUP84 |NUP85 |PAB1 |MORE
Function/Process Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2002) The Saccharomyces cerevisiae nucleoporin Nup2p is a natively unfolded protein. J Biol Chem 277(36):33447-55
Mutants/Phenotypes Strains/Constructs	Fleming JA, et al. (2002) Complementary whole-genome technologies reveal the cellular response to proteasome inhibition by PS-341. Proc Natl Acad Sci U S A 99(3):1461-6	|APN1 |ATG17 |BEM4 |BIK1 |CCR4 |CDC26 |CHL1 |CHL4 |CLB2 |CLB5 |CSM3 |CTF19 |CTF8 |DCC1 |MORE
Function/Process Protein-protein Interactions	Gilchrist D, et al. (2002) Accelerating the rate of disassembly of karyopherin.cargo complexes. J Biol Chem 277(20):18161-72	|CSE1 |GSP1 |KAP95 |NUP1 |SRP1
Cellular Location Mutants/Phenotypes Protein-Nucleic Acid Interactions Substrates/Ligands/Cofactors	Ishii K, et al. (2002) Chromatin boundaries in budding yeast: the nuclear pore connection. Cell 109(5):551-62	|CSE1 |HML |LOS1 |MEX67
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs	Stade K, et al. (2002) A lack of SUMO conjugation affects cNLS-dependent nuclear protein import in yeast. J Biol Chem 277(51):49554-61	|CSE1 |KAP95 |RNA1 |SMT3 |SRM1 |SRP1 |UBA2 |ULP1 |ULP2
Function/Process Protein-protein Interactions Techniques and Reagents	Allen NP, et al. (2001) Proteomic analysis of nucleoporin interacting proteins. J Biol Chem 276(31):29268-74	|GSP1 |KAP95 |NUP1 |NUP100 |NUP116 |NUP42 |NUP49 |NUP57 |NUP60 |NUP84 |SRP1
Cellular Location Function/Process Protein-protein Interactions	Denning D, et al. (2001) The nucleoporin Nup60p functions as a Gsp1p-GTP-sensitive tether for Nup2p at the nuclear pore complex. J Cell Biol 154(5):937-50	|GSP1 |KAP123 |KAP95 |NUP1 |NUP60 |SRM1 |SRP1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Dilworth DJ, et al. (2001) Nup2p dynamically associates with the distal regions of the yeast nuclear pore complex. J Cell Biol 153(7):1465-78	|NUP60 |SRP1
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Reviews	Kunzler M and Hurt E (2001) Targeting of Ran: variation on a common theme? J Cell Sci 114(Pt 18):3233-41	|DIS3 |GSP1 |MOG1 |NTF2 |RNA1 |SRM1 |YRB1 |YRB2
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Hood JK, et al. (2000) Nup2p is located on the nuclear side of the nuclear pore complex and coordinates Srp1p/importin-alpha export. J Cell Sci 113 ( Pt 8):1471-80	|CSE1 |NUP1 |SRP1
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Cellular Location Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Solsbacher J, et al. (2000) Nup2p, a yeast nucleoporin, functions in bidirectional transport of importin alpha. Mol Cell Biol 20(22):8468-79	|CSE1 |GSP1 |KAP95 |NUP1 |SRP1
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Stage-Zimmermann T, et al. (2000) Factors affecting nuclear export of the 60S ribosomal subunit in vivo. Mol Biol Cell 11(11):3777-89	|CRM1 |CSE1 |DBP5 |FAL1 |GLE1 |GLE2 |KAP104 |KAP120 |KAP123 |KAP95 |MEX67 |MSN5 |MTR10 |MTR2 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Booth JW, et al. (1999) The yeast nucleoporin Nup2p is involved in nuclear export of importin alpha/Srp1p. J Biol Chem 274(45):32360-7	|CSE1 |GSP1 |SRM1 |SRP1
Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions	Titov AA and Blobel G (1999) The karyopherin Kap122p/Pdr6p imports both subunits of the transcription factor IIA into the nucleus. J Cell Biol 147(2):235-46	|KAP122 |NUP1 |TOA1 |TOA2
Function/Process Mutants/Phenotypes Protein Processing/Modification/Regulation RNA Levels and Processing Strains/Constructs Transcription	Hauser NC, et al. (1998) Transcriptional profiling on all open reading frames of Saccharomyces cerevisiae. Yeast 14(13):1209-21
Protein-protein Interactions	Hellmuth K, et al. (1998) Yeast Los1p has properties of an exportin-like nucleocytoplasmic transport factor for tRNA. Mol Cell Biol 18(11):6374-86	|GCD11 |GSP1 |GSP2 |LOS1 |MEX67 |NSP1 |YRB1
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP42 |MORE
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Cellular Location Fungal Related Genes/Proteins Genetic Interactions	Noguchi E, et al. (1997) Yrb2p, a Nup2p-related yeast protein, has a functional overlap with Rna1p, a yeast Ran-GTPase-activating protein. Mol Cell Biol 17(4):2235-46	|GSP1 |RNA1 |SRM1 |YRB1 |YRB2
Other Features	Rosenblum JS, et al. (1997) A nuclear import pathway for a protein involved in tRNA maturation. J Cell Biol 139(7):1655-61	|KAP95 |LHP1 |RPL11B |RPL25 |RPL31A |RPL31B |SRP1 |SXM1
Function/Process Mutants/Phenotypes Strains/Constructs	Saavedra CA, et al. (1997) Yeast heat shock mRNAs are exported through a distinct pathway defined by Rip1p. Genes Dev 11(21):2845-56	|GLE1 |GSP1 |NPL3 |NUP120 |NUP145 |NUP159 |NUP42 |SSA1 |SSA4
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP42 |NUP49 |MORE
Regulation of	Kenna MA, et al. (1996) Yeast N1e3p/Nup170p is required for normal stoichiometry of FG nucleoporins within the nuclear pore complex. Mol Cell Biol 16(5):2025-36	|NUP1 |NUP157 |NUP170 |NUP82 |RNA1 |SRP1 |YRB1
Reviews	Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP49 |NUP60 |POM152 |POM34
Reviews	Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP49 |NUP60 |POM152 |POM34
Protein-protein Interactions Regulation of	Dingwall C, et al. (1995) A family of Ran binding proteins that includes nucleoporins. Proc Natl Acad Sci U S A 92(16):7525-9	|GSP1 |YRB1 |YRB2
Reviews	Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41	|NIC96 |NUP100 |NUP116 |NUP133 |NUP159 |NUP188 |NUP57 |NUP82 |NUP84 |NUP85 |POM152
Protein-protein Interactions	Rexach M and Blobel G (1995) Protein import into nuclei: association and dissociation reactions involving transport substrate, transport factors, and nucleoporins. Cell 83(5):683-92	|GSP1 |KAP95 |NUP1 |NUP145 |NUP57 |SRP1
Cellular Location Function/Process Protein-protein Interactions	Belanger KD, et al. (1994) Genetic and physical interactions between Srp1p and nuclear pore complex proteins Nup1p and Nup2p. J Cell Biol 126(3):619-30	|NUP1 |SRP1
Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs Techniques and Reagents	Loeb JD, et al. (1993) NUP2, a novel yeast nucleoporin, has functional overlap with other proteins of the nuclear pore complex. Mol Biol Cell 4(2):209-22	|NSP1 |NUP1

Return to SGD

Send a Message to the SGD Curators