---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

CTS1/YLR286C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXII: 710138 to 708450 CDS: 710138 - 708450 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
CTS1	YLR286C		ORF, Verified	S000004276
Description
Endochitinase, required for cell separation after mitosis; transcriptional activation during the G1 phase of the cell cycle is mediated by transcription factor Ace2p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By catalytic activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR013781 Assigned on 2007-05-23 UniProtKB cation binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR013781 Assigned on 2007-05-23 UniProtKB chitin binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0147 Assigned on 2007-05-23 UniProtKB chitinase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR005089 Assigned on 2009-01-12 UniProtKB GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:3.2.1.14 Assigned on 2007-05-23 UniProtKB endochitinase activity Correa JU, et al. (1982) Endochitinase, a mannan-associated enzyme from Saccharomyces cerevisiae. J Biol Chem 257(3):1392-7      IDA : Inferred from Direct Assay Assigned on 2005-04-18 SGD hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2007-05-23 UniProtKB hydrolase activity, acting on glycosyl bonds GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0326 Assigned on 2007-05-23 UniProtKB hydrolase activity, hydrolyzing O-glycosyl compounds DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001579 Assigned on 2009-11-20 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By carbohydrate metabolic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001579 , EBI:IPR013781 Assigned on 2009-11-20 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0119 Assigned on 2009-11-20 UniProtKB cellular cell wall organization GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0961 Assigned on 2008-02-14 UniProtKB chitin catabolic process Kuranda MJ and Robbins PW (1987) Cloning and heterologous expression of glycosidase genes from Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 84(9):2585-9      IC : Inferred By Curator from chitinase activity Assigned on 2005-04-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR005089 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0146 Assigned on 2007-05-23 UniProtKB cytokinesis, completion of separation Kuranda MJ and Robbins PW (1991) Chitinase is required for cell separation during growth of Saccharomyces cerevisiae. J Biol Chem 266(29):19758-67      IMP : Inferred from Mutant Phenotype Assigned on 2002-09-27 SGD metabolic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0326 Assigned on 2007-05-23 UniProtKB polysaccharide catabolic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0624 Assigned on 2007-05-23 UniProtKB translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cell wall GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0134 Assigned on 2008-02-14 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0041 Assigned on 2009-05-06 UniProtKB cellular bud neck Colman-Lerner A, et al. (2001) Yeast Cbk1 and Mob2 activate daughter-specific genetic programs to induce asymmetric cell fates. Cell 107(6):739-50        IDA : Inferred from Direct Assay Assigned on 2009-12-11 SGD endoplasmic reticulum Kumar A, et al. (2002) Subcellular localization of the yeast proteome. Genes Dev 16(6):707-19              IDA : Inferred from Direct Assay Assigned on 2002-05-07 SGD extracellular region Kuranda MJ and Robbins PW (1991) Chitinase is required for cell separation during growth of Saccharomyces cerevisiae. J Biol Chem 266(29):19758-67      IDA : Inferred from Direct Assay Assigned on 2002-09-27 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0964 Assigned on 2008-02-14 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0243 Assigned on 2008-05-01 UniProtKB Curwin AJ, et al. (2009) Phospholipid Transfer Protein Sec14 Is Required for Trafficking from Endosomes and Regulates Distinct trans-Golgi Export Pathways. J Biol Chem 284(11):7364-75        IDA : Inferred from Direct Assay Assigned on 2009-09-15 SGD fungal-type cell wall Kuranda MJ and Robbins PW (1991) Chitinase is required for cell separation during growth of Saccharomyces cerevisiae. J Biol Chem 266(29):19758-67      IDA : Inferred from Direct Assay Assigned on 2009-12-11 SGD Colman-Lerner A, et al. (2001) Yeast Cbk1 and Mob2 activate daughter-specific genetic programs to induce asymmetric cell fates. Cell 107(6):739-50        IDA : Inferred from Direct Assay Assigned on 2009-12-11 SGD nuclear envelope Kumar A, et al. (2002) Subcellular localization of the yeast proteome. Genes Dev 16(6):707-19              IDA : Inferred from Direct Assay Assigned on 2002-05-07 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forCTS1/YLR286C for CTS1 1) O'Conallain C, et al. (1999) Regulated nuclear localisation of the yeast transcription factor Ace2p controls expression of chitinase (CTS1) in Saccharomyces cerevisiae. Mol Gen Genet 262(2):275-82      2) Kuranda MJ and Robbins PW (1991) Chitinase is required for cell separation during growth of Saccharomyces cerevisiae. J Biol Chem 266(29):19758-67      3) Dohrmann PR, et al. (1992) Parallel pathways of gene regulation: homologous regulators SWI5 and ACE2 differentially control transcription of HO and chitinase. Genes Dev 6(1):93-104

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for CTS1/YLR286C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for CTS1/YLR286C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSLLYII C-term YLESNYF Length(aa) 562 MW(Da) 59,014 pI 4.22 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.218   Codon Adaptation Index 0.210   Frequency of Optimal Codons 0.530   Hydropathicity of Protein -0.102   Aromaticity Score 0.091

10 20 30 40 50 | | | | | MSLLYIILLFTQFLLLPTDAFDRSANTNIAVYWGQNSAGTQESLATYCES SDADIFLLSFLNQFPTLGLNFANACSDTFSDGLLHCTQIAEDIETCQSLG KKVLLSLGGASGSYLFSDDSQAETFAQTLWDTFGEGTGASERPFDSAVVD GFDFDIENNNEVGYSALATKLRTLFAEGTKQYYLSAAPQCPYPDASVGDL LENADIDFAFIQFYNNYCSVSGQFNWDTWLTYAQTVSPNKNIKLFLGLPG SASAAGSGYISDTSLLESTIADIASSSSFGGIALWDASQAFSNELNGEPY VEILKNLLTSASQTATTTVATSKTSAASTSSASTSSASTSQKKTTQSTTS TQSKSKVTLSPTASSAIKTSITQTTKTLTSSTKTKSSLGTTTTESTLNSV AITSMKTTLSSQITSAALVTPQTTTTSIVSSAPIQTAITSTLSPATKSSS VVSLQTATTSTLSPTTTSTSSGSTSSGSTSSDSTARTLAKELNAQYAAGK LNGKSTCTEGEIACSADGKFAVCDHSAWVYMECASGTTCYAYDSGDSVYT QCNFSYLESNYF*

Protein Structures from PDB: proteins of known structure with sequence similarity to CTS1/YLR286C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to CTS1 Homolog Source (per PDB) Protein Alignment: CTS1 vs. Homolog External Links P-Value %Identical %Similar Alignment 2uy2 ( Chain: A) Sccts1_apo crystal structure PDB_Info PDB_Structure Saccharomyces cerevisiae 1.3e-112 100 0 View alignment SCOP MMDB CATH 2uy5 ( Chain: A) Sccts1_kinetin crystal structure PDB_Info PDB_Structure Saccharomyces cerevisiae 1.3e-112 100 0 View alignment SCOP MMDB CATH 2uy3 ( Chain: A) Sccts1_8-chlorotheophylline crystal structure PDB_Info PDB_Structure Saccharomyces cerevisiae 1.3e-112 100 0 View alignment SCOP MMDB CATH 2uy4 ( Chain: A) Sccts1_acetazolamide crystal structure PDB_Info PDB_Structure Saccharomyces cerevisiae 1.3e-112 100 0 View alignment SCOP MMDB CATH 2hvm ( Chain: A) Hevamine a at 1.8 angstrom resolution PDB_Info PDB_Structure Hevea brasiliensis 6.4e-30 38 29 View alignment SCOP MMDB CATH 1hvq ( Chain: A) Crystal structures of hevamine, a plant defence protein with chitinase and lysozyme activity, and its complex with an inhibitor PDB_Info PDB_Structure Hevea brasiliensis 6.4e-30 38 29 View alignment SCOP MMDB CATH 1llo ( Chain: A) Hevamine a (a plant endochitinase/lysozyme) complexed with allosamidin PDB_Info PDB_Structure Hevea brasiliensis 6.4e-30 38 29 View alignment SCOP MMDB CATH 2gsj ( Chain: A) Cdna cloning and 1.75a crystal structure determination of ppl2, a novel chimerolectin from parkia platycephala seeds exhibiting endochitinolytic activity PDB_Info PDB_Structure Parkia platycephala 2.3e-29 39 29 View alignment SCOP MMDB CATH 1kr0 ( Chain: A) Hevamine mutant d125a/y183f in complex with tetra-nag PDB_Info PDB_Structure Hevea brasiliensis 4.8e-29 38 28 View alignment SCOP MMDB CATH 1kr1 ( Chain: A) Hevamine mutant d125a/e127a in complex with tetra-nag PDB_Info PDB_Structure Hevea brasiliensis 7.4e-29 38 28 View alignment SCOP MMDB CATH 1kqy ( Chain: A) Hevamine mutant d125a/e127a/y183f in complex with penta-nag PDB_Info PDB_Structure Hevea brasiliensis 1.3e-28 37 29 View alignment SCOP MMDB CATH 1kqz ( Chain: A) Hevamine mutant d125a/e127a/y183f in complex with tetra-nag PDB_Info PDB_Structure Hevea brasiliensis 1.3e-28 37 29 View alignment SCOP MMDB CATH 3d5h ( Chain: A) Crystal structure of haementhin from haemanthus multiflorus at 2.0a resolution: formation of a novel loop on a tim barrel fold and its functional significance PDB_Info PDB_Structure Scadoxus multiflorus 4.4e-25 38 24 View alignment SCOP MMDB CATH 1cnv ( Chain: A) Crystal structure of concanavalin b at 1.65 a resolution PDB_Info PDB_Structure Canavalia ensiformis 4.6e-19 31 32 View alignment SCOP MMDB CATH 1te1 ( Chain: A) Crystal structure of family 11 xylanase in complex with inhibitor (xip-i) PDB_Info PDB_Structure Triticum aestivum | Penicillium funiculosum 1.6e-11 27 32 View alignment SCOP MMDB CATH 1om0 ( Chain: A) Crystal structure of xylanase inhibitor protein (xip-i) from wheat PDB_Info PDB_Structure Triticum aestivum 1.6e-11 27 32 View alignment SCOP MMDB CATH 1ta3 ( Chain: A) Crystal structure of xylanase (gh10) in complex with inhibitor (xip) PDB_Info PDB_Structure Triticum aestivum | Emericella nidulans 1.6e-11 27 32 View alignment SCOP MMDB CATH 3ebv ( Chain: A) Crystal structure of putative chitinase a from streptomyces coelicolor. PDB_Info PDB_Structure Streptomyces coelicolor 2.2e-06 26 32 View alignment SCOP MMDB CATH 3ian ( Chain: A) Chitinase PDB_Info PDB_Structure Unknown 4.0e-05 25 30 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
CTS1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YLR286C	SGD Systematic Sequence
850992	NCBI: Gene ID
NP_013388.1	NCBI: RefSeq protein version ID
NP_013388.1	NCBI: RefSeq protein version ID
6323316	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
75 curated references; 0 references not yet curated
Regulation of Transcription	Bourens M, et al. (2009) Mutations in the Saccharomyces cerevisiae kinase Cbk1p lead to a fertility defect that can be suppressed by the absence of Brr1p or Mpt5p (Puf5p), proteins involved in RNA metabolism. Genetics 183(1):161-73	|ACE2 |AGA2 |BAR1 |BRR1 |CBK1 |DSE2 |HMLALPHA1 |HMLALPHA2 |HMRA1 |HMRA2 |MATALPHA1 |MATALPHA2 |MFA1 |MFA2 |MORE
Other Features	Campiteli MG, et al. (2009) A reliable measure of similarity based on dependency for short time series: an application to gene expression networks. BMC Bioinformatics 10:270	|CDC15 |MFA1 |PHO11 |PHO12 |PHO5
Fungal Related Genes/Proteins	Cote P, et al. (2009) Transcriptional analysis of the Candida albicans cell cycle. Mol Biol Cell 20(14):3363-73	|ACE2 |APC1 |ASE1 |CDC14 |CDC20 |CDC27 |CDC28 |CDC5 |CDC6 |CHS1 |CHS3 |CLB4 |CSE4 |DBF2 |MORE
Protein Processing/Modification/Regulation Regulation of	Curwin AJ, et al. (2009) Phospholipid Transfer Protein Sec14 Is Required for Trafficking from Endosomes and Regulates Distinct trans-Golgi Export Pathways. J Biol Chem 284(11):7364-75	|ARL1 |ARL3 |BGL2 |BRE5 |CDH1 |CIS3 |CLN2 |CSR1 |ECM33 |EXG1 |GYP1 |HSP150 |KEX2 |PDR17 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Frydlova I, et al. (2009) Deregulation of DSE1 gene expression results in aberrant budding within the birth scar and cell wall integrity pathway activation in Saccharomyces cerevisiae. Eukaryot Cell 8(4):586-94	|CHS1 |DSE1 |ISW2 |SLT2
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gomez A, et al. (2009) Slt2 and Rim101 contribute independently to the correct assembly of the chitin ring at the budding yeast neck in Saccharomyces cerevisiae. Eukaryot Cell 8(9):1449-59	|BNI4 |CCT7 |CDC3 |CHS1 |CHS3 |GFA1 |MYO1 |RIM101 |SKT5 |SLT2
Cross-species Expression Strains/Constructs	Ikeda Y, et al. (2009) Identification and characterization of a gene required for alpha1,2-mannose extension in the O-linked glycan synthesis pathway in Schizosaccharomyces pombe. FEMS Yeast Res 9(1):115-25	|KRE2 |KTR1 |KTR3
Protein-Nucleic Acid Interactions Regulation of Transcription	Pondugula S, et al. (2009) Coupling phosphate homeostasis to cell cycle-specific transcription: mitotic activation of Saccharomyces cerevisiae PHO5 by Mcm1 and Forkhead proteins. Mol Cell Biol 29(18):4891-905	|CDC15 |CDC20 |CLB2 |FKH1 |FKH2 |MCM1 |PHO4 |PHO5 |SDS3
Cellular Location Mutants/Phenotypes RNA Levels and Processing	Bourens M, et al. (2008) Mutations in a small region of the exportin Crm1p disrupt the daughter cell-specific nuclear localization of the transcription factor Ace2p in Saccharomyces cerevisiae. Biol Cell 100(6):343-54	|ACE2 |CBK1 |CRM1 |MOB2 |YAP1
Fungal Related Genes/Proteins	Dunkler A, et al. (2008) An Ashbya gossypii cts2 mutant deficient in a sporulation-specific chitinase can be complemented by Candida albicans CHT4. Microbiol Res 163(6):701-10	|CTS2
Reviews	Lengeler KB, et al. (2008) Protein-O-mannosyltransferases in virulence and development. Cell Mol Life Sci 65(4):528-44	|AGA1 |AGA2 |AXL2 |BAR1 |CIS3 |FUS1 |GAS1 |HSP150 |KEX2 |KRE9 |MID2 |PIR1 |PIR3 |PMT1 |MORE
Regulation of Transcription	Sbia M, et al. (2008) Regulation of the yeast Ace2 transcription factor during the cell cycle. J Biol Chem 283(17):11135-45	|ACE2 |CBK1 |SWI5
Genetic Interactions Mutants/Phenotypes Regulation of Strains/Constructs Transcription	Verma-Gaur J, et al. (2008) RAM pathway contributes to Rpb4 dependent pseudohyphal differentiation in Saccharomyces cerevisiae. Fungal Genet Biol 45(10):1373-9	|ACE2 |DSE1 |GPA2 |MEP2 |MUC1 |RAS2 |RPB4 |SCW11 |TEC1
Protein Physical Properties	de Godoy LM, et al. (2008) Comprehensive mass-spectrometry-based proteome quantification of haploid versus diploid yeast. Nature 455(7217):1251-4	|ACT1 |AFR1 |ASG7 |AXL1 |BAR1 |BEM1 |BNI1 |CDC24 |CDC28 |CDC42 |CLN1 |CLN2 |CLN3 |DIG1 |MORE
Evolution Fungal Related Genes/Proteins	Coronado JE, et al. (2007) Conserved processes and lineage-specific proteins in fungal cell wall evolution. Eukaryot Cell 6(12):2269-77	|ACF2 |AGA1 |AGA2 |ANS1 |BAR1 |BGL2 |BSC1 |CCW12 |CCW14 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |MORE
Reviews	Goto M (2007) Protein o-glycosylation in fungi: diverse structures and multiple functions. Biosci Biotechnol Biochem 71(6):1415-27	|BAR1 |GAS1 |HSP150 |KEX2 |KRE2 |KRE9 |KTR1 |KTR3 |PMT1 |PMT2 |PMT3 |PMT4 |PMT5 |PMT6 |MORE
Protein Physical Properties Protein Sequence Features Protein/Nucleic Acid Structure	Hurtado-Guerrero R and van Aalten DM (2007) Structure of Saccharomyces cerevisiae chitinase 1 and screening-based discovery of potent inhibitors. Chem Biol 14(5):589-99
Regulation of Transcription	Sprowl JA, et al. (2007) Changes in expression of cell wall turnover genes accompany inhibition of chromosome segregation by bovine protein kinase C alpha expression in Saccharomyces cerevisiae. Cell Biol Int 31(10):1160-72	|DSE1 |DSE2 |SVS1
Cell Cycle Phase Involved DNA/RNA Sequence Features Mutants/Phenotypes RNA Levels and Processing Strains/Constructs Transcription	Voth WP, et al. (2007) Forkhead proteins control the outcome of transcription factor binding by antiactivation. EMBO J 26(20):4324-34	|ACE2 |AIM44 |AMN1 |ASH1 |BAR1 |BUD9 |CDC6 |CLB2 |DSE1 |DSE2 |DSE3 |DSE4 |EGT2 |FAA3 |MORE
Regulation of Transcription	Yuan S and Li KC (2007) Context-dependent clustering for dynamic cellular state modeling of microarray gene expression. Bioinformatics 23(22):3039-47	|ACE2 |ADD37 |AIM44 |AMN1 |ATP1 |ATP15 |ATP17 |ATP20 |ATP7 |COR1 |COX12 |COX13 |COX5A |COX6 |MORE
Regulation of Transcription	Buck MJ and Lieb JD (2006) A chromatin-mediated mechanism for specification of conditional transcription factor targets. Nat Genet 38(12):1446-51	|ACA1 |ACS1 |ADE3 |ADH1 |AGP1 |AIM38 |ANP1 |AQY1 |ASC1 |AST2 |ATG19 |AZF1 |BDF1 |BSC3 |MORE
Mutants/Phenotypes	Kawahata M, et al. (2006) Yeast genes involved in response to lactic acid and acetic acid: acidic conditions caused by the organic acids in Saccharomyces cerevisiae cultures induce expression of intracellular metal metabolism genes regulated by Aft1p. FEMS Yeast Res 6(6):924-36	|AFT1 |ARN1 |ARN2 |ATO3 |COT1 |DAK2 |DAL5 |DSE2 |EAF1 |EAF3 |EAF5 |EAF6 |EGT2 |FET3 |MORE
Reviews	Klis FM, et al. (2006) Cell wall construction in Saccharomyces cerevisiae. Yeast 23(3):185-202	|AGA1 |BGL2 |CHS1 |CHS2 |CHS3 |CIS3 |CLB2 |CLN2 |CRH1 |CWP1 |CWP2 |DAN1 |DAN4 |DCW1 |MORE
Reviews	Lesage G and Bussey H (2006) Cell wall assembly in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(2):317-43	|ANP1 |BGL2 |BIG1 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |CHS6 |CHS7 |CNE1 |CRH1 |CRR1 |CTS2 |MORE
Regulation of Transcription	Bro C, et al. (2005) Improvement of galactose uptake in Saccharomyces cerevisiae through overexpression of phosphoglucomutase: example of transcript analysis as a tool in inverse metabolic engineering. Appl Environ Microbiol 71(11):6465-72	|ARG1 |ARI1 |CEG1 |CLN1 |ECM5 |GAL1 |GAL10 |GAL2 |GAL4 |GAL7 |GAL80 |HXT10 |HXT13 |HXT15 |MORE
Fungal Related Genes/Proteins	Dunkler A, et al. (2005) Candida albicans CHT3 encodes the functional homolog of the Cts1 chitinase of Saccharomyces cerevisiae. Fungal Genet Biol 42(11):935-47	|CTS2
Reviews	Schuller D and Casal M (2005) The use of genetically modified Saccharomyces cerevisiae strains in the wine industry. Appl Microbiol Biotechnol 68(3):292-304	|ALD6 |ATF1 |ATH1 |CAR1 |CTS2 |CUP1-1 |CUP1-2 |FLO1 |GPD1 |GSY1 |GSY2 |HXK1 |HXK2 |HXT1 |MORE
RNA Levels and Processing Regulation of	Voth WP, et al. (2005) ACE2, CBK1, and BUD4 in budding and cell separation. Eukaryot Cell 4(6):1018-28	|ACE2 |BUD4 |CBK1 |DSE2 |EGT2 |HYM1 |KIC1 |MOB2 |SCW11 |SWI5
Regulation of Transcription	Vyas VK, et al. (2005) Repressors Nrg1 and Nrg2 regulate a set of stress-responsive genes in Saccharomyces cerevisiae. Eukaryot Cell 4(11):1882-91	|ADK2 |AGA2 |AGP2 |AIM13 |AIM19 |AIM34 |AIM36 |ALD4 |ASG7 |ATP15 |ATP16 |ATP17 |ATP18 |ATP2 |MORE
Reviews	Yeong FM (2005) Severing all ties between mother and daughter: cell separation in budding yeast. Mol Microbiol 55(5):1325-31	|ASE1 |CDC10 |CDC11 |CDC12 |CDC3 |DSE4
Regulation of Transcription	Kottom TJ and Limper AH (2004) Pneumocystis carinii cell wall biosynthesis kinase gene CBK1 is an environmentally responsive gene that complements cell wall defects of cbk-deficient yeast. Infect Immun 72(8):4628-36	|CBK1
Transcription	Schneper L, et al. (2004) The Ras/protein kinase A pathway acts in parallel with the Mob2/Cbk1 pathway to effect cell cycle progression and proper bud site selection. Eukaryot Cell 3(1):108-20	|ACE2 |BUB2 |CBK1 |CDC28 |HYM1 |KIC1 |MOB2 |RAS2 |SWE1 |TAO3 |TPK1
Function/Process Mutants/Phenotypes Strains/Constructs	Selvaggini S, et al. (2004) Independent regulation of chitin synthase and chitinase activity in Candida albicans and Saccharomyces cerevisiae. Microbiology 150(Pt 4):921-8	|CHS1 |CHS2 |CHS3
Other Features	Shinya T, et al. (2004) Cell-lytic activity of tobacco BY-2 induced by a fungal elicitor from alternaria alternata attributed to the expression of a class I beta-1,3-glucanase gene. Biosci Biotechnol Biochem 68(6):1265-72
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process Transcription	Ufano S, et al. (2004) Swm1p subunit of the APC/cyclosome is required for activation of the daughter-specific gene expression program mediated by Ace2p during growth at high temperature in Saccharomyces cerevisiae. J Cell Sci 117(Pt 4):545-57	|ACE2 |CDC28 |CLB2 |DSE1 |DSE2 |DSE4 |SCW11 |SWM1
Cross-species Expression Function/Process	Carstens M, et al. (2003) The Saccharomyces cerevisiae chitinase, encoded by the CTS1-2 gene, confers antifungal activity against Botrytis cinerea to transgenic tobacco. Transgenic Res 12(4):497-508
Regulation of Transcription	Lamb TM and Mitchell AP (2003) The transcription factor Rim101p governs ion tolerance and cell differentiation by direct repression of the regulatory genes NRG1 and SMP1 in Saccharomyces cerevisiae. Mol Cell Biol 23(2):677-86	|ENA1 |NRG1 |PRB1 |PRM7 |RIM101 |RIM8 |SMP1 |YJR061W |ZPS1
Regulation of Transcription	Zhang L, et al. (2002) Expression profiling of the response of Saccharomyces cerevisiae to 5-fluorocytosine using a DNA microarray. Int J Antimicrob Agents 20(6):444-50	|EGT2
Cellular Location Function/Process Regulation of	Bidlingmaier S, et al. (2001) The Cbk1p pathway is important for polarized cell growth and cell separation in Saccharomyces cerevisiae. Mol Cell Biol 21(7):2449-62	|ACE2 |CBK1 |HYM1 |SCW11
Cell Cycle Phase Involved Cellular Location Protein Processing/Modification/Regulation Strains/Constructs Transcription	Colman-Lerner A, et al. (2001) Yeast Cbk1 and Mob2 activate daughter-specific genetic programs to induce asymmetric cell fates. Cell 107(6):739-50	|ACE2 |AMN1 |ASH1 |CBK1 |DSE1 |DSE2 |DSE3 |DSE4 |MOB2 |PRY3 |SCW11
Function/Process Regulation of	Doolin MT, et al. (2001) Overlapping and distinct roles of the duplicated yeast transcription factors Ace2p and Swi5p. Mol Microbiol 40(2):422-32	|ACE2 |AIM44 |AMN1 |DSE1 |DSE2 |DSE3 |NIS1 |PIR1 |SCW11 |SWI5 |YNL046W
Cell Cycle Phase Involved RNA Levels and Processing Regulation of	Simon I, et al. (2001) Serial regulation of transcriptional regulators in the yeast cell cycle. Cell 106(6):697-708	|ACE2 |AGA1 |AGA2 |ALK1 |APC1 |ARP7 |ASH1 |BUD4 |BUD8 |BUD9 |CDC20 |CDC21 |CDC45 |CDC6 |MORE
Function/Process Regulation of Transcription	Versele M and Thevelein JM (2001) Lre1 affects chitinase expression, trehalose accumulation and heat resistance through inhibition of the Cbk1 protein kinase in Saccharomyces cerevisiae. Mol Microbiol 41(6):1311-26	|ACE2 |CBK1 |HLR1 |LRE1 |MSN2 |MSN4 |RIM15 |SCH9 |YAK1
Function/Process Regulation of	Pan X and Heitman J (2000) Sok2 regulates yeast pseudohyphal differentiation via a transcription factor cascade that regulates cell-cell adhesion. Mol Cell Biol 20(22):8364-72	|ASH1 |CLB1 |CLB2 |EGT2 |FLO8 |MUC1 |PHD1 |SOK2 |SWI5 |TPK1 |TPK2 |TPK3
Function/Process Regulation of Strains/Constructs Transcription	Racki WJ, et al. (2000) Cbk1p, a protein similar to the human myotonic dystrophy kinase, is essential for normal morphogenesis in Saccharomyces cerevisiae. EMBO J 19(17):4524-32	|ACE2 |CBK1 |LRE1 |MOB2 |NOT3 |SEC2 |SSD1 |YOL036W
Regulation of Transcription	Zhang DY, et al. (2000) Intramolecular interaction of yeast TFIIB in transcription control. Nucleic Acids Res 28(9):1913-20	|ACE2 |GAL4 |RPB10 |RPB11 |RPB2 |RPB3 |RPB4 |RPB5 |RPB7 |RPB8 |RPB9 |RPC10 |RPO21 |RPO26 |MORE
RNA Levels and Processing Regulation of	Ferea TL, et al. (1999) Systematic changes in gene expression patterns following adaptive evolution in yeast. Proc Natl Acad Sci U S A 96(17):9721-6	|ACO1 |ACS1 |ADE5,7 |ADH1 |ADH2 |ALD4 |ALD6 |ATP1 |ATP14 |ATP16 |ATP17 |ATP3 |ATP4 |ATP5 |MORE
Regulation of	Galitski T, et al. (1999) Ploidy regulation of gene expression. Science 285(5425):251-4	|CLN1 |COS8 |CRC1 |CTR3 |DSE4 |GIC2 |MUC1 |NDI1 |PCL1 |PRY2 |RGI1 |VEL1 |YGL193C |YNR065C |MORE
Cellular Location	Kunze I, et al. (1999) The green fluorescent protein targets secretory proteins to the yeast vacuole Biochim Biophys Acta 1410(3):287-98	|KAR2
Cell Cycle Phase Involved Regulation of Transcription	McBride HJ, et al. (1999) Distinct regions of the Swi5 and Ace2 transcription factors are required for specific gene activation. J Biol Chem 274(30):21029-36	|ACE2 |ASH1 |CDC6 |EGT2 |HO |PCL2 |PCL9 |PHO2 |RME1 |SIC1 |SWI5
Regulation of Transcription	O'Conallain C, et al. (1999) Regulated nuclear localisation of the yeast transcription factor Ace2p controls expression of chitinase (CTS1) in Saccharomyces cerevisiae. Mol Gen Genet 262(2):275-82	|ACE2 |CDC28 |SWI5
Cellular Location Function/Process	Cappellaro C, et al. (1998) New potential cell wall glucanases of Saccharomyces cerevisiae and their involvement in mating. J Bacteriol 180(19):5030-7	|BGL2 |EXG1 |SCW10 |SCW11 |SCW4 |SUN4
RNA Levels and Processing Regulation of	Gray NS, et al. (1998) Exploiting chemical libraries, structure, and genomics in the search for kinase inhibitors. Science 281(5376):533-8	|ACH1 |ATR1 |BDH2 |CAK1 |CDC28 |CLB1 |CLB2 |CTT1 |CYC3 |DSE2 |EGT2 |FAR1 |GPG1 |GPH1 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Regulation of Strains/Constructs	King L and Butler G (1998) Ace2p, a regulator of CTS1 (chitinase) expression, affects pseudohyphal production in Saccharomyces cerevisiae. Curr Genet 34(3):183-91	|ACE2 |FLO8
Cellular Location	Neiman AM (1998) Prospore membrane formation defines a developmentally regulated branch of the secretory pathway in yeast. J Cell Biol 140(1):29-37	|GAS1 |SEC1 |SEC4 |SEC8 |SEC9 |SPO20
Fungal Related Genes/Proteins Regulation of	Ozer J, et al. (1998) Association of transcription factor IIA with TATA binding protein is required for transcriptional activation of a subset of promoters and cell cycle progression in Saccharomyces cerevisiae. Mol Cell Biol 18(5):2559-70	|CLB1 |CLB2 |CLN1 |CUP1-1 |CUP1-2 |DED1 |ENO2 |GAL1 |GAL80 |HIS3 |PHO5 |PMA1 |SPT15 |TOA1 |MORE
Function/Process Other Features Substrates/Ligands/Cofactors	Rodriguez-Medina JR, et al. (1998) Elevated expression of chitinase 1 and chitin synthesis in myosin II-deficient Saccharomyces cerevisiae. Cell Mol Biol (Noisy-le-grand) 44(6):919-25	|MYO1
Protein Processing/Modification/Regulation	Gentzsch M and Tanner W (1997) Protein-O-glycosylation in yeast: protein-specific mannosyltransferases. Glycobiology 7(4):481-6	|AGA2 |BAR1 |GAS1 |HSP150 |KEX2 |KRE9 |PMT1 |PMT2 |PMT3 |PMT4 |PMT5 |PMT6
Regulation of	King L and Butler G (1997) Regulation of expression of the chitinase gene CTS1 in Saccharomyces cerevisiae. Biochem Soc Trans 25(3):555S	|ACE2
DNA/RNA Sequence Features Protein-Nucleic Acid Interactions Regulation of	Dohrmann PR, et al. (1996) Role of negative regulation in promoter specificity of the homologous transcriptional activators Ace2p and Swi5p. Mol Cell Biol 16(4):1746-58	|ACE2 |HO |NCE1 |NCE2 |NCE3 |PHO2 |SIN5 |SWI5
Other Features	Izumida H, et al. (1996) The effect of chitinase inhibitors, cyclo(Arg-Pro) against cell separation of Saccharomyces cerevisiae and the morphological change of Candida albicans. J Antibiot (Tokyo) 49(8):829-31
Other Features	Kovacech B, et al. (1996) EGT2 gene transcription is induced predominantly by Swi5 in early G1. Mol Cell Biol 16(7):3264-74	|ACE2 |EGT2 |HO |SWI5
Other Features	Jiang YW and Stillman DJ (1995) Regulation of HIS4 expression by the Saccharomyces cerevisiae SIN4 transcriptional regulator. Genetics 140(1):103-14	|HIS4 |HMLALPHA2 |MATALPHA2 |PHO2 |RAP1 |SIN4 |SNF2
Regulation of Transcription	Jiang YW, et al. (1995) Genetic and physical interactions between yeast RGR1 and SIN4 in chromatin organization and transcriptional regulation. Genetics 140(1):47-54	|HO |IME1 |RGR1 |SIN4
Fungal Related Genes/Proteins	McCreath KJ, et al. (1995) Molecular cloning and characterization of chitinase genes from Candida albicans. Proc Natl Acad Sci U S A 92(7):2544-8
Fungal Related Genes/Proteins	Pishko EJ, et al. (1995) Isolation and characterization of two chitinase-encoding genes (cts1, cts2) from the fungus Coccidioides immitis. Gene 167(1-2):173-7	|CTS2
Function/Process	Hartland RP, et al. (1994) The linkage of (1-3)-beta-glucan to chitin during cell wall assembly in Saccharomyces cerevisiae. Yeast 10(12):1591-9	|CDC24 |CHS3
Regulation of Transcription	Dohrmann PR, et al. (1992) Parallel pathways of gene regulation: homologous regulators SWI5 and ACE2 differentially control transcription of HO and chitinase. Genes Dev 6(1):93-104	|ACE2 |HO |SWI4 |SWI5 |SWI6
Regulation of Transcription	Jiang YW and Stillman DJ (1992) Involvement of the SIN4 global transcriptional regulator in the chromatin structure of Saccharomyces cerevisiae. Mol Cell Biol 12(10):4503-14	|HIS4 |LYS2 |SIN4
Cell Cycle Phase Involved DNA/RNA Sequence Features Regulation of Transcription	Lowndes NF, et al. (1992) SWI6 protein is required for transcription of the periodically expressed DNA synthesis genes in budding yeast. Nature 357(6378):505-8	|CLN1 |CLN2 |HO |SWI4 |SWI6
DNA/RNA Sequence Features Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Regulation of Strains/Constructs	Kuranda MJ and Robbins PW (1991) Chitinase is required for cell separation during growth of Saccharomyces cerevisiae. J Biol Chem 266(29):19758-67	|SEC18 |SEC6 |SEC7
DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins Other Features Strains/Constructs	Kuranda MJ and Robbins PW (1987) Cloning and heterologous expression of glycosidase genes from Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 84(9):2585-9	|AMS1 |EXG1
Function/Process Protein Physical Properties	Correa JU, et al. (1982) Endochitinase, a mannan-associated enzyme from Saccharomyces cerevisiae. J Biol Chem 257(3):1392-7
Cellular Location Function/Process	Elango N, et al. (1982) Secretory character of yeast chitinase. J Biol Chem 257(3):1398-400

Return to SGD

Send a Message to the SGD Curators