SEC22/YLR268W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXII: 680202 to 680846
CDS: 680202 - 680846

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

SEC22 YLR268W SLY2, TSL26 ORF, Verified S000004258

Description
R-SNARE protein; assembles into SNARE complex with Bet1p, Bos1p and Sed5p; cycles between the ER and Golgi complex; involved in anterograde and retrograde transport between the ER and Golgi; synaptobrevin homolog

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
SNAP receptor activity Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ER to Golgi vesicle-mediated transport Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
intra-Golgi vesicle-mediated transport Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
retrograde vesicle-mediated transport, Golgi to ER Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR011012
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
vesicle fusion Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
vesicle-mediated transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001388 , EBI:IPR010908
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0931
Assigned on 2008-02-14 UniProtKB
Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
Golgi apparatus Ballensiefen W, et al. (1998) Recycling of the yeast v-SNARE Sec22p involves COPI-proteins and the ER transmembrane proteins Ufe1p and Sec20p. J Cell Sci 111 ( Pt 11):1507-20
       IDA : Inferred from Direct Assay
Assigned on 2002-09-17 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0333
Assigned on 2008-02-14 UniProtKB
Golgi apparatus part Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7
             RCA : Reviewed Computational Analysis
Assigned on 2009-09-03 YeastFunc
endoplasmic reticulum Ballensiefen W, et al. (1998) Recycling of the yeast v-SNARE Sec22p involves COPI-proteins and the ER transmembrane proteins Ufe1p and Sec20p. J Cell Sci 111 ( Pt 11):1507-20
       IDA : Inferred from Direct Assay
Assigned on 2002-09-17 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane Ossig R, et al. (1991) The yeast SLY gene products, suppressors of defects in the essential GTP-binding Ypt1 protein, may act in endoplasmic reticulum-to-Golgi transport. Mol Cell Biol 11(6):2980-93
     IDA : Inferred from Direct Assay
Assigned on 2002-10-01 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001388 , EBI:IPR010908
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9908
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forSEC22/YLR268W for SEC22
1) Liu Y and Barlowe C (2002) Analysis of Sec22p in endoplasmic reticulum/Golgi transport reveals cellular redundancy in SNARE protein function. Mol Biol Cell 13(9):3314-24

2) Liu Y, et al. (2004) Sec22p export from the endoplasmic reticulum is independent of SNARE pairing. J Biol Chem 279(26):27225-32

3) Novick P and Schekman R (1979) Secretion and cell-surface growth are blocked in a temperature-sensitive mutant of Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 76(4):1858-62

4) Novick P, et al. (1980) Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SEC22/YLR268W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SEC22/YLR268W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MIKSTLI

C-term FWWIFLK

Length(aa) 214

MW(Da) 25,058

pI 7.34

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.211

Codon Adaptation Index 0.189

Frequency of Optimal Codons 0.544

Hydropathicity of Protein -0.309

Aromaticity Score 0.140

10 20 30 40 50 | | | | | MIKSTLIYREDGLPLCTSVDNENDPSLFEQKQKVKIVVSRLTPQSATEAT LESGSFEIHYLKKSMVYYFVICESGYPRNLAFSYLNDIAQEFEHSFANEY PKPTVRPYQFVNFDNFLQMTKKSYSDKKVQDNLDQLNQELVGVKQIMSKN IEDLLYRGDSLDKMSDMSSSLKETSKRYRKSAQKINFDLLISQYAPIVIV AFFFVFLFWWIFLK*

Protein Structures from PDB: proteins of known structure with sequence similarity to SEC22/YLR268W, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to SEC22 Homolog Source (per PDB) Protein Alignment: SEC22 vs. Homolog External Links
P-Value %Identical %Similar Alignment
2nut ( Chain: C)
Crystal structure of the human sec23a/24a heterodimer, complexed with the snare protein sec22b
PDB_Info
PDB_Structure
Homo sapiens 1.3e-25 39 38 View alignment SCOP
MMDB
CATH
2nup ( Chain: C)
Crystal structure of the human sec23a/24a heterodimer, complexed with the snare protein sec22b
PDB_Info
PDB_Structure
Homo sapiens 1.3e-25 39 38 View alignment SCOP
MMDB
CATH
3egx ( Chain: C)
Crystal structure of the mammalian copii-coat protein sec23a/24a complexed with the snare protein sec22b and bound to the transport signal sequence of the snare protein bet1
PDB_Info
PDB_Structure
Homo sapiens 1.5e-20 40 36 View alignment SCOP
MMDB
CATH
3egd ( Chain: C)
Crystal structure of the mammalian copii-coat protein sec23a/24a complexed with the snare protein sec22 and bound to the transport signal sequence of vesicular stomatitis virus glycoprotein
PDB_Info
PDB_Structure
Homo sapiens 1.5e-20 40 36 View alignment SCOP
MMDB
CATH
1ifq ( Chain: A, B)
Sec22b n-terminal domain
PDB_Info
PDB_Structure
Mus musculus Chain A = 8.4e-15 40 37 View alignment SCOP
MMDB
CATH
Chain B = 8.4e-15 40 37 View alignment
1gl2 ( Chain: A)
Crystal structure of an endosomal snare core complex
PDB_Info
PDB_Structure
Rattus norvegicus | Mus musculus 0.000810 36 46 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
SEC22 Novick P, et al. (1980) Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15

Standard Name	Reference
SEC22	*Novick P, et al.* (1980)** Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YLR268W SGD Systematic Sequence

850973 NCBI: Gene ID

NP_013370.1 NCBI: RefSeq protein version ID

NP_013370.1 NCBI: RefSeq protein version ID

6323298 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YLR268W	SGD Systematic Sequence
850973	NCBI: Gene ID
NP_013370.1	NCBI: RefSeq protein version ID
NP_013370.1	NCBI: RefSeq protein version ID
6323298	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
113 curated references; 0 references not yet curated
Computational analysis
Evolution
Fungal Related Genes/Proteins
Kienle N, et al. (2009) Phylogeny of the SNARE vesicle fusion machinery yields insights into the conservation of the secretory pathway in fungi. BMC Evol Biol 9:19
       |BET1 |BOS1 |NYV1 |PEP12 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SPO20 |SRO7 |SRO77 |SSO1 |SSO2 |MORE
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Ren Y, et al. (2009) A structure-based mechanism for vesicle capture by the multisubunit tethering complex Dsl1. Cell 139(6):1119-29
       |DSL1 |EXO70 |SEC17 |SEC20 |SEC39 |TIP20 |UFE1 |USE1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Singh I, et al. (2009) Stringent mating-type-regulated auxotrophy increases the accuracy of systematic genetic interaction screens with Saccharomyces cerevisiae mutant arrays. Genetics 181(1):289-300
         |ADH1 |CAN1 |HML |HMR |LYP1 |MF(ALPHA)1 |MFA1 |PTC1 |RNR1 |STE2 |TEF1 |THR1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Yakir-Tamang L and Gerst JE (2009) A phosphatidylinositol-transfer protein and phosphatidylinositol-4-phosphate 5-kinase control Cdc42 to regulate the actin cytoskeleton and secretory pathway in yeast. Mol Biol Cell 20(15):3583-97
       |CDC24 |CDC42 |MSS4 |MYO2 |SAC1 |SEC1 |SEC12 |SEC14 |SEC15 |SEC2 |SEC3 |SEC4 |SEC8 |SEC9 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Zou J, et al. (2009) Regulation of cell polarity through phosphorylation of Bni4 by Pho85 G1 cyclin-dependent kinases in Saccharomyces cerevisiae. Mol Biol Cell 20(14):3239-50
       |AIM44 |APL3 |AXL1 |BCK1 |BEM1 |BEM2 |BNI1 |BNI4 |BNR1 |BOI1 |BOP3 |BUD22 |BUD3 |BUD4 |MORE
Function/Process
Mutants/Phenotypes
Abe F and Minegishi H (2008) Global screening of genes essential for growth in high-pressure and cold environments: searching for basic adaptive strategies using a yeast deletion library. Genetics 178(2):851-72
       |ACO1 |AGP1 |AGP2 |AGP3 |AKR1 |ALP1 |ARD1 |ARG82 |ARO1 |ARO2 |ATP15 |AVL9 |BAP2 |BAP3 |MORE
Mutants/Phenotypes
Strains/Constructs
Duennwald ML and Lindquist S (2008) Impaired ERAD and ER stress are early and specific events in polyglutamine toxicity. Genes Dev 22(23):3308-3319
       |CDC48 |CUE1 |HAC1 |IRE1 |NPL4 |OLE1 |PMR1 |PRC1 |PRE1 |PRE2 |PRE9 |RAD6 |RPN2 |SEC61 |MORE
Genetic Interactions
Higashio H, et al. (2008) Smy2p Participates in COPII Vesicle Formation Through the Interaction with Sec23p/Sec24p Subcomplex. Traffic 9(1):79-93
         |BET1 |COG2 |COG3 |RET1 |RET3 |SAR1 |SEC12 |SEC13 |SEC16 |SEC17 |SEC18 |SEC20 |SEC21 |SEC23 |MORE
Cellular Location
Protein Processing/Modification/Regulation
Strains/Constructs
Techniques and Reagents
Kamena F, et al. (2008) Ypt1p is essential for retrograde Golgi-ER transport and for Golgi maintenance in S. cerevisiae. J Cell Sci 121(Pt 8):1293-302
       |ANP1 |ARF1 |BOS1 |EMP47 |KAR2 |MNN1 |SED5 |SLY1 |UFE1 |YPT1 |YPT31 |YPT32
Reviews
Sacher M, et al. (2008) The TRAPP complex: insights into its architecture and function. Traffic 9(12):2032-42
       |BET3 |BET5 |GSG1 |KRE11 |SAR1 |SEC23 |SEC24 |TRS120 |TRS130 |TRS20 |TRS23 |TRS31 |TRS33 |YKT6 |MORE
Cellular Location
Mutants/Phenotypes
Protein-protein Interactions
Regulation of
Strains/Constructs
Schuldiner M, et al. (2008) The GET complex mediates insertion of tail-anchored proteins into the ER membrane. Cell 134(4):634-45
       |BOS1 |GET1 |GET2 |GET3 |GOS1 |KAR2 |PEP12 |PEX15 |SBH1 |SBH2 |SCS2 |SED5 |TLG2 |UBC6 |MORE
Mutants/Phenotypes
Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90
       |ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ARV1 |ATG17 |ATP17 |BDF1 |BEM1 |MORE
Genetic Interactions
Mutants/Phenotypes
Yang HJ, et al. (2008) Binding interactions control SNARE specificity in vivo. J Cell Biol 183(6):1089-100
     |NYV1 |SEC9 |SNC1 |SNC2 |SPO20 |SSO1 |SSO2 |YKT6
Fungal Related Genes/Proteins
Kuratsu M, et al. (2007) Systematic analysis of SNARE localization in the filamentous fungus Aspergillus oryzae. Fungal Genet Biol 44(12):1310-23
       |BET1 |BOS1 |GOS1 |NYV1 |PEP12 |SEC20 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SPO20 |SSO1 |SSO2 |MORE
Reviews
Maxwell PH and Curcio MJ (2007) Host factors that control long terminal repeat retrotransposons in Saccharomyces cerevisiae: implications for regulation of mammalian retroviruses. Eukaryot Cell 6(7):1069-80
       |BRO1 |CPR7 |DBP3 |DBR1 |DEP1 |ELG1 |NUP133 |NUP84 |POP2 |RIM13 |RPL6A |RRM3 |RTT101 |RTT103 |MORE
Mutants/Phenotypes
Nakanishi H, et al. (2007) Erv14 family cargo receptors are necessary for ER exit during sporulation in Saccharomyces cerevisiae. J Cell Sci 120(Pt 5):908-16
     |DTR1 |ERV14 |ERV15 |GCS1 |MSO1 |PMA1 |RCY1 |SMA1 |SMA2 |SSO1 |VPS13
Mutants/Phenotypes
Strains/Constructs
Pagani MA, et al. (2007) Disruption of iron homeostasis in Saccharomyces cerevisiae by high zinc levels: a genome-wide study. Mol Microbiol 65(2):521-37
       |ACO1 |ACO2 |ADE1 |ADE12 |ADE13 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADK1 |AFT1 |AKR1 |ARN1 |MORE
Protein-protein Interactions
Strains/Constructs
Schindler C and Spang A (2007) Interaction of SNAREs with ArfGAPs Precedes Recruitment of Sec18p/NSF. Mol Biol Cell 18(8):2852-63
         |ARF1 |BET1 |BOS1 |GCS1 |GLO3 |NYV1 |SEC17 |SEC18 |SED5 |SNC1 |SSO1 |SSO2 |TLG2 |VAM3 |MORE
Protein-protein Interactions
Strains/Constructs
Shestakova A, et al. (2007) Interaction of the conserved oligomeric Golgi complex with t-SNARE Syntaxin5a/Sed5 enhances intra-Golgi SNARE complex stability. J Cell Biol 179(6):1179-92
       |BET1 |BOS1 |COG1 |COG2 |GOS1 |SED5 |SFT1
Protein Physical Properties
White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36
         |ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |MORE
Mutants/Phenotypes
Strains/Constructs
Zakrzewska A, et al. (2007) Cellular Processes and Pathways That Protect Saccharomyces cerevisiae Cells against the Plasma Membrane-Perturbing Compound Chitosan. Eukaryot Cell 6(4):600-8
         |ALG5 |ALG6 |ALG8 |ALG9 |DID4 |GET1 |GET2 |GET3 |GLO3 |HOG1 |MED1 |PAF1 |PBS2 |RTF1 |MORE
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Protein-protein Interactions
Protein/Nucleic Acid Structure
Strains/Constructs
Flanagan JJ and Barlowe C (2006) Cysteine-disulfide cross-linking to monitor SNARE complex assembly during endoplasmic reticulum-Golgi transport. J Biol Chem 281(4):2281-8
       |BET1 |BOS1 |SED5 |SLY1 |USO1
Cellular Location
Protein Sequence Features
Wen W, et al. (2006) Identification of the Yeast R-SNARE Nyv1p as a Novel Longin Domain-containing Protein. Mol Biol Cell 17(10):4282-99
       |APL5 |APM3 |NYV1 |PEP12 |PHO8 |SNC1 |YCK3 |YKT6
Cellular Location
Protein-protein Interactions
Ballew N, et al. (2005) A Rab requirement is not bypassed in SLY1-20 suppression. Mol Biol Cell 16(4):1839-49
       |BET3 |COG2 |COG3 |ERV41 |SED5 |SLY1 |USO1 |YPT1 |YPT31 |YPT32 |YPT6
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Friesen H, et al. (2005) Interaction of the Saccharomyces cerevisiae cortical actin patch protein Rvs167p with proteins involved in ER to Golgi vesicle trafficking. Genetics 170(2):555-68
       |APP1 |GYL1 |GYP5 |RUD3 |RVS167 |SEC4 |YPT1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Graf CT, et al. (2005) Identification of functionally interacting SNAREs by using complementary substitutions in the conserved '0' layer. Mol Biol Cell 16(5):2263-74
       |BET1 |BOS1 |SED5
Reviews
Hong W (2005) SNAREs and traffic. Biochim Biophys Acta 1744(2):120-44
       |BET1 |BOS1 |GOS1 |NYV1 |PEP12 |SEC20 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SPO20 |SSO1 |SSO2 |MORE
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Li Y, et al. (2005) Structure-based functional analysis reveals a role for the SM protein Sly1p in retrograde transport to the endoplasmic reticulum. Mol Biol Cell 16(9):3951-62
       |BOS1 |DSL1 |SEC20 |SLY1 |TIP20 |UFE1 |USE1
Cellular Location
Strains/Constructs
Luedeke C, et al. (2005) Septin-dependent compartmentalization of the endoplasmic reticulum during yeast polarized growth. J Cell Biol 169(6):897-908
         |BUD6 |CDC12 |CDC48 |GIN4 |HMG1 |HSL1 |PEA2 |SAR1 |SEC18 |SEC61 |SHS1
Mutants/Phenotypes
Strains/Constructs
Roumanie O, et al. (2005) Rho GTPase regulation of exocytosis in yeast is independent of GTP hydrolysis and polarization of the exocyst complex. J Cell Biol 170(4):583-94
       |CDC42 |MYO2 |RHO3 |SEC1 |SEC15 |SEC21 |SEC3 |SEC4 |SEC6 |SEC8 |SEC9 |TPM1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Routt SM, et al. (2005) Nonclassical PITPs activate PLD via the Stt4p PtdIns-4-kinase and modulate function of late stages of exocytosis in vegetative yeast. Traffic 6(12):1157-72
           |CSR1 |LSB6 |MSS4 |PDR16 |PDR17 |PIK1 |PSD1 |SAC1 |SEC1 |SEC10 |SEC12 |SEC13 |SEC14 |SEC15 |MORE
Function/Process
Genetic Interactions
Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19
           |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Weinberger A, et al. (2005) Control of Golgi morphology and function by Sed5 t-SNARE phosphorylation. Mol Biol Cell 16(10):4918-30
       |BET1 |BOS1 |GRH1 |SED5 |YKT6
Mutants/Phenotypes
Strains/Constructs
Wu X and Jiang YW (2005) Genetic/genomic evidence for a key role of polarized endocytosis in filamentous differentiation of S. cerevisiae. Yeast 22(14):1143-53
       |BNI1 |BST1 |BUD2 |BUD5 |BUD6 |BUD8 |EDE1 |PEA2 |PER1 |RSR1 |RVS161 |SHE4 |SLA1 |SNC2 |MORE
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Protein Sequence Features
Reviews
Burri L and Lithgow T (2004) A complete set of SNAREs in yeast. Traffic 5(1):45-52
       |BET1 |BOS1 |FRT1 |FRT2 |GOS1 |NYV1 |PEP12 |SEC20 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SSO1 |MORE
Cellular Location
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Liu Y, et al. (2004) Sec22p export from the endoplasmic reticulum is independent of SNARE pairing. J Biol Chem 279(26):27225-32
       |BET1 |BOS1 |SED5
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process
Protein-protein Interactions
Barrowman J, et al. (2003) The Yip1p.Yif1p complex is required for the fusion competence of endoplasmic reticulum-derived vesicles. J Biol Chem 278(22):19878-84
       |BOS1 |YIF1 |YIP1 |YPT1
Protein-protein Interactions
Burri L, et al. (2003) A SNARE required for retrograde transport to the endoplasmic reticulum. Proc Natl Acad Sci U S A 100(17):9873-7
     |SEC20 |UFE1 |USE1 |YKT6
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Dilcher M, et al. (2003) Use1p is a yeast SNARE protein required for retrograde traffic to the ER. EMBO J 22(14):3664-74
     |BET1 |BOS1 |SEC20 |SED5 |UFE1 |USE1
Reviews
Duden R (2003) ER-to-Golgi transport: COP I and COP II function (Review). Mol Membr Biol 20(3):197-207
       |BET1 |BOS1 |SAR1 |SEC12 |SEC13 |SEC16 |SEC23 |SEC24 |SEC31
Mutants/Phenotypes
Regulatory Role
Griffith JL, et al. (2003) Functional genomics reveals relationships between the retrovirus-like Ty1 element and its host Saccharomyces cerevisiae. Genetics 164(3):867-79
           |APN1 |ARD1 |BEM1 |BUD30 |CBC2 |CTK1 |DBR1 |DOA4 |HOF1 |JNM1 |KCS1 |LSM1 |MCK1 |MFT1 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Krogan NJ, et al. (2003) A Snf2 family ATPase complex required for recruitment of the histone H2A variant Htz1. Mol Cell 12(6):1565-76
           |ACT1 |ARP4 |ARP6 |BDF1 |CDC73 |DST1 |HTZ1 |RVB1 |RVB2 |SET2 |SNF2 |SWC3 |SWC4 |SWC5 |MORE
Genetic Interactions
Strains/Constructs
Krogan NJ, et al. (2003) Methylation of histone H3 by Set2 in Saccharomyces cerevisiae is linked to transcriptional elongation by RNA polymerase II. Mol Cell Biol 23(12):4207-18
         |ARP6 |BEM4 |BRE1 |BRE2 |BRE5 |CDC73 |CHD1 |CTK1 |CTR9 |DCC1 |DEP1 |EAF1 |GIM3 |GIM5 |MORE
Cellular Location
Luo Z and Gallwitz D (2003) Biochemical and genetic evidence for the involvement of yeast Ypt6-GTPase in protein retrieval to different Golgi compartments. J Biol Chem 278(2):791-9
       |YPT6
Protein Sequence Features
Protein-protein Interactions
Regulation of
Miller EA, et al. (2003) Multiple cargo binding sites on the COPII subunit Sec24p ensure capture of diverse membrane proteins into transport vesicles. Cell 114(4):497-509
     |BET1 |BOS1 |EMP24 |EMP47 |ERP1 |ERP2 |GAP1 |PRM8 |SEC13 |SEC23 |SEC24 |SEC31 |SED5 |SFB2 |MORE
Function/Process
Morsomme P, et al. (2003) The ER v-SNAREs are required for GPI-anchored protein sorting from other secretory proteins upon exit from the ER. J Cell Biol 162(3):403-12
     |BET1 |BOS1 |GAS1 |SED5 |USO1 |YPT1
Protein-protein Interactions
Mossessova E, et al. (2003) SNARE selectivity of the COPII coat. Cell 114(4):483-95
     |BET1 |BOS1 |SEC23 |SEC24 |SED5
Mutants/Phenotypes
Strains/Constructs
Ran H, et al. (2003) Human targets of Pseudomonas aeruginosa pyocyanin. Proc Natl Acad Sci U S A 100(24):14315-20
           |BNA2 |BSD2 |BUD30 |CAT5 |CCM1 |CDC50 |CLN2 |COQ1 |DOA4 |ERG24 |FEN1 |FIG2 |GAS1 |GET2 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Bidlingmaier S and Snyder M (2002) Large-scale identification of genes important for apical growth in Saccharomyces cerevisiae by directed allele replacement technology (DART) screening. Funct Integr Genomics 1(6):345-56
       |API2 |CBK1 |CDC34 |COG5 |ECM33 |FAB1 |OPI3 |PAN1 |RAS2 |SLA1 |SLA2 |SMY1 |SPA2 |VID22 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Liu Y and Barlowe C (2002) Analysis of Sec22p in endoplasmic reticulum/Golgi transport reveals cellular redundancy in SNARE protein function. Mol Biol Cell 13(9):3314-24
         |YKT6
Cellular Location
Protein-protein Interactions
Miller E, et al. (2002) Cargo selection into COPII vesicles is driven by the Sec24p subunit. EMBO J 21(22):6105-13
         |BET1 |BOS1 |SAR1 |SEC24 |SFB3
Function/Process
Protein-protein Interactions
Parlati F, et al. (2002) Distinct SNARE complexes mediating membrane fusion in Golgi transport based on combinatorial specificity. Proc Natl Acad Sci U S A 99(8):5424-9
         |BOS1 |GOS1 |SED5 |SFT1 |YKT6
Reviews
Xue M and Zhang B (2002) Do SNARE proteins confer specificity for vesicle fusion? Proc Natl Acad Sci U S A 99(21):13359-61
         |PEP12 |SEC9 |VAM3 |VTI1 |YKT6
Cellular Location
Function/Process
Strains/Constructs
Andag U, et al. (2001) The coatomer-interacting protein Dsl1p is required for Golgi-to-endoplasmic reticulum retrieval in yeast. J Biol Chem 276(42):39150-60
       |COP1 |DSL1 |ERD2 |KAR2 |SEC20 |TIP20
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Gonzalez LC Jr, et al. (2001) A novel snare N-terminal domain revealed by the crystal structure of Sec22b. J Biol Chem 276(26):24203-11

Function/Process
Mutants/Phenotypes
Strains/Constructs
Grant AM, et al. (2001) NBD-labeled phosphatidylcholine and phosphatidylethanolamine are internalized by transbilayer transport across the yeast plasma membrane. Traffic 2(1):37-50
       |SEC1 |SEC11 |SEC12 |SEC14 |SEC18 |SEC21 |SEC6 |SLA2
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2001) Systematic genetic analysis with ordered arrays of yeast deletion mutants. Science 294(5550):2364-8
           |ARC18 |ARC40 |ARP1 |ARP2 |ARP6 |ASE1 |ASF1 |ATS1 |BBC1 |BCK1 |BEM1 |BEM2 |BEM4 |BFA1 |MORE
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Tsui MM, et al. (2001) Selective formation of Sed5p-containing SNARE complexes is mediated by combinatorial binding interactions. Mol Biol Cell 12(3):521-38
       |BET1 |BOS1 |GOS1 |NYV1 |PEP12 |SED5 |SFT1 |SNC2 |TLG1 |VAM3 |VAM7 |VTI1 |YKT6
Function/Process
Mutants/Phenotypes
Strains/Constructs
Bialek-Wyrzykowska U, et al. (2000) Low levels of Ypt protein prenylation cause vesicle polarization defects and thermosensitive growth that can be suppressed by genes involved in cell wall maintenance. Mol Microbiol 35(6):1295-311
       |GDI1 |GFA1 |LRE1 |MLC1 |MRS6 |MYO2 |PKC1 |SEC1 |SEC18 |SEC2 |SEC23 |SEC3 |SEC4 |SEC6 |MORE
Cellular Location
Function/Process
Cao X and Barlowe C (2000) Asymmetric requirements for a Rab GTPase and SNARE proteins in fusion of COPII vesicles with acceptor membranes. J Cell Biol 149(1):55-66
       |BET1 |BOS1 |SED5 |SLY1 |YPT1
Reviews
Clague MJ and Herrmann A (2000) Membrane transport: deciphering fusion. Curr Biol 10(20):R750-2
       |BET1 |BOS1 |NYV1 |SED5 |SNC2 |VAM3 |VAM7
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Kurihara T, et al. (2000) Sec24p and Iss1p function interchangeably in transport vesicle formation from the endoplasmic reticulum in Saccharomyces cerevisiae. Mol Biol Cell 11(3):983-98
       |BET1 |SEC16 |SEC23 |SEC24 |SFB2
Function/Process
Genetic Interactions
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Legesse-Miller A, et al. (2000) Aut7p, a soluble autophagic factor, participates in multiple membrane trafficking processes. J Biol Chem 275(42):32966-73
       |ATG8 |BET1 |NYV1
Function/Process
Strains/Constructs
McNew JA, et al. (2000) Compartmental specificity of cellular membrane fusion encoded in SNARE proteins. Nature 407(6801):153-9
       |BET1 |BOS1 |NYV1 |SEC9 |SED5 |SNC2 |SSO1 |VAM3 |VAM7 |VTI1
Function/Process
Protein-protein Interactions
Parlati F, et al. (2000) Topological restriction of SNARE-dependent membrane fusion. Nature 407(6801):194-8
       |BET1 |BOS1 |SED5
Function/Process
Protein-protein Interactions
Tsui MM and Banfield DK (2000) Yeast Golgi SNARE interactions are promiscuous. J Cell Sci 113 ( Pt 1)():145-52
       |BET1 |BOS1 |GOS1 |SED5 |SFT1 |VTI1 |YKT6
Cellular Location
Function/Process
Strains/Constructs
Ossipov D, et al. (1999) Yeast ER-Golgi v-SNAREs Bos1p and Bet1p differ in steady-state localization and targeting. J Cell Sci 112 ( Pt 22):4135-42
       |BET1 |BOS1 |KEX2
Reviews
Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       |GOS1 |NYV1 |SEC20 |SEC9 |SED5 |SNC1 |SNC2 |SPO20 |SSO1 |SSO2 |TLG1 |TLG2 |UFE1 |VAM3 |MORE
Function/Process
Genetic Interactions
Strains/Constructs
Poon PP, et al. (1999) Retrograde transport from the yeast Golgi is mediated by two ARF GAP proteins with overlapping function. EMBO J 18(3):555-64
       |ARF1 |ARF2 |BET1 |BOS1 |GCS1 |GLO3 |SEC21
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
VanRheenen SM, et al. (1999) Sec34p, a protein required for vesicle tethering to the yeast Golgi apparatus, is in a complex with Sec35p. J Cell Biol 147(4):729-42
       |BET1 |COG2 |COG3 |RUD3 |SLY1 |USO1 |YKT6 |YPT1
Cellular Location
Function/Process
Strains/Constructs
Techniques and Reagents
Ballensiefen W, et al. (1998) Recycling of the yeast v-SNARE Sec22p involves COPI-proteins and the ER transmembrane proteins Ufe1p and Sec20p. J Cell Sci 111 ( Pt 11):1507-20
       |SEC20 |SEC21 |SEC27 |UFE1
DNA/RNA Sequence Features
Fungal Related Genes/Proteins
Fasshauer D, et al. (1998) Conserved structural features of the synaptic fusion complex: SNARE proteins reclassified as Q- and R-SNAREs. Proc Natl Acad Sci U S A 95(26):15781-6
         |BET1 |BOS1 |NYV1 |SEC9 |SED5 |SNC1 |SPO20 |SSO1 |VAM3 |VAM7 |VTI1
Genetic Interactions
Frigerio G (1998) The Saccharomyces cerevisiae early secretion mutant tip20 is synthetic lethal with mutants in yeast coatomer and the SNARE proteins Sec22p and Ufe1p. Yeast 14(7):633-46
       |RET2 |SEC20 |SEC21 |SEC27 |TIP20 |UFE1
Reviews
Gotte M and von Mollard GF (1998) A new beat for the SNARE drum. Trends Cell Biol 8(6):215-8
       |SEC17 |SEC18 |SEC9 |SED5 |SNC1 |SSO1 |VAM3 |VTI1
Genetic Interactions
Jiang Y, et al. (1998) A high copy suppressor screen reveals genetic interactions between BET3 and a new gene. Evidence for a novel complex in ER-to-Golgi transport. Genetics 149(2):833-41
       |ANP1 |BET1 |BET3 |BET5 |BOS1 |DSS4 |USO1 |YPT1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Jones S, et al. (1998) Identification of regulators for Ypt1 GTPase nucleotide cycling. Mol Biol Cell 9(10):2819-37
       |GYP1 |GYP7 |SEC17 |SEC18 |YPT1
Cellular Location
Function/Process
Strains/Constructs
Matsuoka K, et al. (1998) Coat assembly directs v-SNARE concentration into synthetic COPII vesicles. Mol Cell 2(5):703-8
       |BOS1 |SEC12 |UFE1
Function/Process
Strains/Constructs
Spang A and Schekman R (1998) Reconstitution of retrograde transport from the Golgi to the ER in vitro. J Cell Biol 143(3):589-99
       |ARF1 |BET1 |BOS1 |EMP47 |PBI2 |SEC18 |TRX1 |TRX2 |UFE1 |USO1
Function/Process
Protein-protein Interactions
Springer S and Schekman R (1998) Nucleation of COPII vesicular coat complex by endoplasmic reticulum to Golgi vesicle SNAREs. Science 281(5377):698-700
       |BET1 |BOS1 |SAR1 |SEC23 |SEC24 |YKT6
Non-Fungal Related Genes/Proteins
Tang BL, et al. (1998) Hsec22c: a homolog of yeast Sec22p and mammalian rsec22a and msec22b/ERS-24. Biochem Biophys Res Commun 243(3):885-91
       |BET1
Genetic Interactions
VanRheenen SM, et al. (1998) Sec35p, a novel peripheral membrane protein, is required for ER to Golgi vesicle docking. J Cell Biol 141(5):1107-19
       |BET1 |COG2 |COG3 |SLY1 |USO1 |YKT6 |YPT1
Reviews
Weimbs T, et al. (1998) A model for structural similarity between different SNARE complexes based on sequence relationships. Trends Cell Biol 8(7):260-2
       |BET1 |BOS1 |NYV1 |PEP12 |SEC9 |SNC1 |SPO20 |SSO1 |VTI1
Function/Process
Mutants/Phenotypes
Protein Processing/Modification/Regulation
Protein Sequence Features
Protein-protein Interactions
Regulation of
Strains/Constructs
Campbell JL and Schekman R (1997) Selective packaging of cargo molecules into endoplasmic reticulum-derived COPII vesicles. Proc Natl Acad Sci U S A 94(3):837-42
         |EMP24 |SAR1 |SEC12 |SEC13 |SEC16 |SEC23 |SEC24 |SEC31
Mutants/Phenotypes
Gaynor EC and Emr SD (1997) COPI-independent anterograde transport: cargo-selective ER to Golgi protein transport in yeast COPI mutants. J Cell Biol 136(4):789-802
       |HSP150 |SEC18 |SEC21
Reviews
Hay JC and Scheller RH (1997) SNAREs and NSF in targeted membrane fusion. Curr Opin Cell Biol 9(4):505-12
     |BET1 |BOS1 |NYV1 |PEP12 |SED5 |SFT1 |SSO1 |VAM3 |YKT6
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Lewis MJ, et al. (1997) A novel SNARE complex implicated in vesicle fusion with the endoplasmic reticulum. EMBO J 16(11):3017-24
       |SEC20 |TIP20 |UFE1
Function/Process
Protein-protein Interactions
Lupashin VV and Waters MG (1997) t-SNARE activation through transient interaction with a rab-like guanosine triphosphatase. Science 276(5316):1255-8
       |BET1 |SEC18 |SED5 |SLY1 |YPT1
Fungal Related Genes/Proteins
Lupashin VV, et al. (1997) Characterization of a novel yeast SNARE protein implicated in Golgi retrograde traffic. Mol Biol Cell 8(12):2659-76
       |HSP150 |SEC17 |SEC18 |SED5 |SFT1 |VTI1 |YKT6
Cellular Location
Non-Fungal Related Genes/Proteins
Paek I, et al. (1997) ERS-24, a mammalian v-SNARE implicated in vesicle traffic between the ER and the Golgi. J Cell Biol 137(5):1017-28

Function/Process
Protein Sequence Features
Protein-protein Interactions
Sacher M, et al. (1997) The synaptobrevin-related domains of Bos1p and Sec22p bind to the syntaxin-like region of Sed5p. J Biol Chem 272(27):17134-8
       |BOS1 |SED5
Cellular Location
Non-Fungal Related Genes/Proteins
Hay JC, et al. (1996) Mammalian vesicle trafficking proteins of the endoplasmic reticulum and Golgi apparatus. J Biol Chem 271(10):5671-9
       |BET1
Genetic Interactions
Sapperstein SK, et al. (1996) Assembly of the ER to Golgi SNARE complex requires Uso1p. J Cell Biol 132(5):755-67
     |BET1 |BOS1 |SLY1 |USO1 |YKT6 |YPT1
Reviews
Schekman R and Orci L (1996) Coat proteins and vesicle budding. Science 271(5255):1526-33
     |BET1 |BOS1 |SEC13 |SEC16 |SEC23 |SEC24 |SEC31
Reviews
Bennett MK (1995) SNAREs and the specificity of transport vesicle targeting. Curr Opin Cell Biol 7(4):581-6
     |BET1 |BOS1 |YKT6
Strains/Constructs
Boehm J, et al. (1994) Kex2-dependent invertase secretion as a tool to study the targeting of transmembrane proteins which are involved in ER-->Golgi transport in yeast. EMBO J 13(16):3696-710
     |BET1 |KEX2 |RER1 |SEC12
Genetic Interactions
Duden R, et al. (1994) Yeast beta- and beta'-coat proteins (COP). Two coatomer subunits essential for endoplasmic reticulum-to-Golgi protein traffic. J Biol Chem 269(39):24486-95
     |ARF1 |ARF2 |BET1 |BOS1 |SEC18 |SEC21 |SEC26 |SEC27
Other Features
Strains/Constructs
Letourneur F, et al. (1994) Coatomer is essential for retrieval of dilysine-tagged proteins to the endoplasmic reticulum. Cell 79(7):1199-207
       |COP1 |GDI1 |SEC12 |SEC13 |SEC16 |SEC17 |SEC21 |SEC23 |SEC27 |STE2
Function/Process
Protein-protein Interactions
Lian JP, et al. (1994) Ypt1p implicated in v-SNARE activation. Nature 372(6507):698-701
     |BOS1 |YPT1
Cellular Location
Techniques and Reagents
Rexach MF, et al. (1994) Characteristics of endoplasmic reticulum-derived transport vesicles. J Cell Biol 126(5):1133-48
     |BET1 |BOS1 |KAR2 |SEC61 |YPT1
Protein-protein Interactions
Sogaard M, et al. (1994) A rab protein is required for the assembly of SNARE complexes in the docking of transport vesicles. Cell 78(6):937-48
       |BET1 |BOS1 |SED5 |SLY1 |YKT6 |YPT1
Cellular Location
Genetic Interactions
Lian JP and Ferro-Novick S (1993) Bos1p, an integral membrane protein of the endoplasmic reticulum to Golgi transport vesicles, is required for their fusion competence. Cell 73(4):735-45
       |BET1 |BOS1 |YPT1
Alias
Newman AP, et al. (1992) SEC22 and SLY2 are identical. Mol Cell Biol 12(8):3663-4

Genetic Interactions
Mutants/Phenotypes
Dascher C, et al. (1991) Identification and structure of four yeast genes (SLY) that are able to suppress the functional loss of YPT1, a member of the RAS superfamily. Mol Cell Biol 11(2):872-85
     |BET1 |SLY1 |SLY41 |YPT1
Cellular Location
Genetic Interactions
Mutants/Phenotypes
Ossig R, et al. (1991) The yeast SLY gene products, suppressors of defects in the essential GTP-binding Ypt1 protein, may act in endoplasmic reticulum-to-Golgi transport. Mol Cell Biol 11(6):2980-93
     |BET1 |SEC21 |SLY1 |SLY41 |YPT1
Function/Process
Mutants/Phenotypes
Puoti A, et al. (1991) Biosynthesis of mannosylinositolphosphoceramide in Saccharomyces cerevisiae is dependent on genes controlling the flow of secretory vesicles from the endoplasmic reticulum to the Golgi. J Cell Biol 113(3):515-25
       |SEC12 |SEC13 |SEC14 |SEC16 |SEC17 |SEC18 |SEC20 |SEC21 |SEC23 |SEC6 |SEC7
Genetic Interactions
Shim J, et al. (1991) The BOS1 gene encodes an essential 27-kD putative membrane protein that is required for vesicular transport from the ER to the Golgi complex in yeast. J Cell Biol 113(1):55-64
     |BET1 |BOS1
Mutants/Phenotypes
Strains/Constructs
Kaiser CA and Schekman R (1990) Distinct sets of SEC genes govern transport vesicle formation and fusion early in the secretory pathway. Cell 61(4):723-33
       |SEC12 |SEC13 |SEC16 |SEC17 |SEC18 |SEC23
Reviews
Newman AP and Ferro-Novick S (1990) Defining components required for transport from the ER to the Golgi complex in yeast. Bioessays 12(10):485-91
     |ARF1 |ARF2 |BET1 |BET2 |BOS1 |SAR1 |SEC12 |SEC13 |SEC16 |SEC17 |SEC18 |SEC20 |SEC21 |SEC23 |MORE
Genetic Interactions
Newman AP, et al. (1990) BET1, BOS1, and SEC22 are members of a group of interacting yeast genes required for transport from the endoplasmic reticulum to the Golgi complex. Mol Cell Biol 10(7):3405-14
     |BET1 |BOS1 |SEC21
Function/Process
Mutants/Phenotypes
Strains/Constructs
Ramirez RM, et al. (1983) Plasma membrane expansion terminates in Saccharomyces cerevisiae secretion-defective mutants while phospholipid synthesis continues. J Bacteriol 154(3):1276-83
     |GDI1 |SEC1 |SEC10 |SEC11 |SEC12 |SEC13 |SEC14 |SEC15 |SEC16 |SEC17 |SEC18 |SEC2 |SEC20 |SEC21 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Novick P, et al. (1981) Order of events in the yeast secretory pathway. Cell 25(2):461-9
       |GDI1 |SEC1 |SEC12 |SEC14 |SEC15 |SEC16 |SEC18 |SEC2 |SEC20 |SEC21 |SEC23 |SEC3 |SEC4 |SEC5 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Novick P, et al. (1980) Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15
       |GDI1 |SEC1 |SEC10 |SEC11 |SEC12 |SEC13 |SEC14 |SEC15 |SEC16 |SEC17 |SEC18 |SEC2 |SEC20 |SEC21 |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.