ERF2/YLR246W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXII: 627120 to 628199
CDS: 627120 - 628199

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ERF2 YLR246W ORF, Verified S000004236

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 1999-07-21. Gene name expires on 2000-07-21.
Description
Subunit of a palmitoyltransferase, composed of Erf2p and Shr5p, that adds a palmitoyl lipid moiety to heterolipidated substrates such as Ras1p and Ras2p through a thioester linkage; mutants partially mislocalize Ras2p to the vacuole

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
acyltransferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0012
Assigned on 2007-05-23 UniProtKB
metal ion binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0479
Assigned on 2007-05-23 UniProtKB
protein-cysteine S-palmitoleyltransferase activity Dong X, et al. (2003) Palmitoylation and plasma membrane localization of Ras2p by a nonclassical trafficking pathway in Saccharomyces cerevisiae. Mol Cell Biol 23(18):6574-84
     IMP : Inferred from Mutant Phenotype
Assigned on 2005-03-04 SGD
contributes_to protein-cysteine S-palmitoleyltransferase activity Lobo S, et al. (2002) Identification of a Ras palmitoyltransferase in Saccharomyces cerevisiae. J Biol Chem 277(43):41268-73
       IDA : Inferred from Direct Assay
Assigned on 2007-03-15 SGD
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
zinc ion binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001594
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0862
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
protein amino acid palmitoylation Bartels DJ, et al. (1999) Erf2, a novel gene product that affects the localization and palmitoylation of Ras2 in Saccharomyces cerevisiae. Mol Cell Biol 19(10):6775-87
       IMP : Inferred from Mutant Phenotype
Assigned on 2007-03-15 SGD
Lobo S, et al. (2002) Identification of a Ras palmitoyltransferase in Saccharomyces cerevisiae. J Biol Chem 277(43):41268-73
       IDA : Inferred from Direct Assay
Assigned on 2003-01-23 SGD
Roth AF, et al. (2006) Global analysis of protein palmitoylation in yeast. Cell 125(5):1003-13
         IMP : Inferred from Mutant Phenotype
Assigned on 2006-11-13 SGD
protein targeting to membrane Bartels DJ, et al. (1999) Erf2, a novel gene product that affects the localization and palmitoylation of Ras2 in Saccharomyces cerevisiae. Mol Cell Biol 19(10):6775-87
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-23 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to endoplasmic reticulum membrane Bartels DJ, et al. (1999) Erf2, a novel gene product that affects the localization and palmitoylation of Ras2 in Saccharomyces cerevisiae. Mol Cell Biol 19(10):6775-87
       IDA : Inferred from Direct Assay
Assigned on 2002-09-23 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
palmitoyltransferase complex Lobo S, et al. (2002) Identification of a Ras palmitoyltransferase in Saccharomyces cerevisiae. J Biol Chem 277(43):41268-73
       IPI : Inferred from Physical Interaction
Assigned on 2005-02-17 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forERF2/YLR246W for ERF2
1) Bartels DJ, et al. (1999) Erf2, a novel gene product that affects the localization and palmitoylation of Ras2 in Saccharomyces cerevisiae. Mol Cell Biol 19(10):6775-87

2) Lobo S, et al. (2002) Identification of a Ras palmitoyltransferase in Saccharomyces cerevisiae. J Biol Chem 277(43):41268-73

3) Roth AF, et al. (2006) Global analysis of protein palmitoylation in yeast. Cell 125(5):1003-13

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERF2/YLR246W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERF2/YLR246W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MALVSRR

C-term FEKIQKI

Length(aa) 359

MW(Da) 41,099

pI 10.12

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.013

Codon Adaptation Index 0.098

Frequency of Optimal Codons 0.395

Hydropathicity of Protein 0.020

Aromaticity Score 0.123

10 20 30 40 50 | | | | | MALVSRRSTRSESTSITKEEHTGEGSLTKLFFRWLVTLEGDQDINDGKGY ISLPNVSNYIFFLGGRFRTVKGAKPLWLGVLLAIVCPMVLFSIFEAHKLW HTQNGYKVLVIFFYYFWVITLASFIRTATSDPGVLPRNIHLSQLRNNYQI PQEYYNLITLPTHSSISKDITIKYCPSCRIWRPPRSSHCSTCNVCVMVHD HHCIWVNNCIGKRNYRFFLIFLLGAILSSVILLTNCAIHIARESGGPRDC PVAILLLCYAGLTLWYPAILFTYHIFMAGNQQTTREFLKGIGSKKNPVFH RVVKEENIYNKGSFLKNMGHLMLEPRGPSFVSARKPHEAGDWRFMDLSPA HSFEKIQKI*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERF2/YLR246W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
ERF2 2001-10-09 SGD (2007) Information without a citation in SGD

Standard Name	Date Standardized	Reference
ERF2	2001-10-09	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YLR246W SGD Systematic Sequence

850947 NCBI: Gene ID

NP_013347.1 NCBI: RefSeq protein version ID

NP_013347.1 NCBI: RefSeq protein version ID

6323275 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YLR246W	SGD Systematic Sequence
850947	NCBI: Gene ID
NP_013347.1	NCBI: RefSeq protein version ID
NP_013347.1	NCBI: RefSeq protein version ID
6323275	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
21 curated references; 0 references not yet curated
Function/Process
Protein Physical Properties
Substrates/Ligands/Cofactors
Jennings BC, et al. (2009) 2-Bromopalmitate and 2-(2-hydroxy-5-nitro-benzylidene)-benzo[b]thiophen-3-one inhibit DHHC-mediated palmitoylation in vitro. J Lipid Res 50(2):233-42
       |PFA3 |SHR5 |VAC8
Function/Process
Regulatory Role
Substrates/Ligands/Cofactors
Nadolski MJ and Linder ME (2009) Molecular recognition of the palmitoylation substrate vac8 by its palmitoyltransferase pfa3. J Biol Chem 284(26):17720-30
       |AKR1 |MEH1 |PFA3 |PFA4 |PFA5 |VAC8 |YGL108C
Non-Fungal Related Genes/Proteins
Reviews
Nadolski MJ and Linder ME (2007) Protein lipidation. FEBS J 274(20):5202-5210
       |AKR1 |AKR2 |CHS3 |LCB4 |PFA3 |PFA4 |PFA5 |RAS2 |SHR5 |SWF1 |TLG1 |TUL1 |VAC8 |YCK2
DNA/RNA Sequence Features
Steigele S, et al. (2007) Comparative analysis of structured RNAs in S. cerevisiae indicates a multitude of different functions. BMC Biol 5:25
       |AIM5 |ALR1 |AMA1 |ARC40 |ARG1 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |ASR1 |ATP2 |BMH1 |BMH2 |BRP1 |MORE
Protein Sequence Features
Tartaglia GG and Caflisch A (2007) Computational analysis of the S. cerevisiae proteome reveals the function and cellular localization of the least and most amyloidogenic proteins. Proteins 68(1):273-8
         |HXT10 |IMH1 |IST2 |MOT1 |PBP1 |SEC23 |SPT5 |URE2
Reviews
Mitchell DA, et al. (2006) Protein palmitoylation by a family of DHHC protein S-acyltransferases. J Lipid Res 47(6):1118-27
       |AKR1 |PFA3 |PFA4 |PFA5 |SWF1 |VAC8 |YCK1 |YCK2 |YCK3 |YKT6 |YNL155W
Cellular Location
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Strains/Constructs
Ohno Y, et al. (2006) Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins. Biochim Biophys Acta 1761(4):474-83
       |AKR1 |AKR2 |PFA3 |PFA4 |PFA5 |SWF1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Roth AF, et al. (2006) Global analysis of protein palmitoylation in yeast. Cell 125(5):1003-13
         |AGP1 |AKR1 |AKR2 |ANR2 |BAP2 |BAP3 |BET3 |CDC42 |ENV7 |GAP1 |GNP1 |GPA1 |GPA2 |HIP1 |MORE
Mutants/Phenotypes
Strains/Constructs
Hou H, et al. (2005) The DHHC protein Pfa3 affects vacuole-associated palmitoylation of the fusion factor Vac8. Proc Natl Acad Sci U S A 102(48):17366-71
       |AKR1 |AKR2 |MEH1 |PFA3 |PFA4 |PFA5 |SWF1 |VAC8 |YCK3
Function/Process
Mutants/Phenotypes
Strains/Constructs
Smotrys JE, et al. (2005) The vacuolar DHHC-CRD protein Pfa3p is a protein acyltransferase for Vac8p. J Cell Biol 170(7):1091-9
       |PFA3 |PFA4 |PFA5 |SWF1
Non-Fungal Related Genes/Proteins
Swarthout JT, et al. (2005) DHHC9 and GCP16 constitute a human protein fatty acyltransferase with specificity for H- and N-Ras. J Biol Chem 280(35):31141-8
         |SHR5
Fungal Related Genes/Proteins
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Valdez-Taubas J and Pelham H (2005) Swf1-dependent palmitoylation of the SNARE Tlg1 prevents its ubiquitination and degradation. EMBO J 24(14):2524-32
         |AKR1 |AKR2 |BSD2 |PFA3 |PFA4 |PFA5 |SNC1 |SWF1 |SYN8 |TLG1 |TUL1
Reviews
Dietrich LE and Ungermann C (2004) On the mechanism of protein palmitoylation. EMBO Rep 5(11):1053-7
       |AKR1 |VAC8 |YKT6
Function/Process
Non-Fungal Related Genes/Proteins
Reviews
Linder ME and Deschenes RJ (2004) Model organisms lead the way to protein palmitoyltransferases. J Cell Sci 117(Pt 4):521-6
       |AKR1 |SHR5 |YCK2
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Dong X, et al. (2003) Palmitoylation and plasma membrane localization of Ras2p by a nonclassical trafficking pathway in Saccharomyces cerevisiae. Mol Cell Biol 23(18):6574-84
     |RAS2 |SEC18 |SHR5
Function/Process
Protein Sequence Features
Li B, et al. (2002) Aph2, a protein with a zf-DHHC motif, interacts with c-Abl and has pro-apoptotic activity. J Biol Chem 277(32):28870-6
       |AKR1
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Substrates/Ligands/Cofactors
Techniques and Reagents
Lobo S, et al. (2002) Identification of a Ras palmitoyltransferase in Saccharomyces cerevisiae. J Biol Chem 277(43):41268-73
       |RAS2 |SHR5
Cellular Location
Function/Process
Mutants/Phenotypes
Strains/Constructs
Zhao L, et al. (2002) Erf4p and Erf2p form an endoplasmic reticulum-associated complex involved in the plasma membrane localization of yeast Ras proteins. J Biol Chem 277(51):49352-9
       |RAS2 |SHR5
Function/Process
Protein Sequence Features
Fetrow JS, et al. (2001) Genomic-scale comparison of sequence- and structure-based methods of function prediction: does structure provide additional insight? Protein Sci 10(5):1005-14
       |CDD1 |EPS1 |EUG1 |GRX1 |GRX2 |GRX3 |GRX4 |GRX5 |GRX6 |GRX7 |GRX8 |LEU5 |MPD1 |MPD2 |MORE
Cellular Location
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Bartels DJ, et al. (1999) Erf2, a novel gene product that affects the localization and palmitoylation of Ras2 in Saccharomyces cerevisiae. Mol Cell Biol 19(10):6775-87
       |GPA2 |PFA3 |PFA4 |PFA5 |RAS2 |SHR5 |SWF1
Non-Fungal Related Genes/Proteins
Putilina T, et al. (1999) The DHHC domain: a new highly conserved cysteine-rich motif. Mol Cell Biochem 195(1-2):219-26
           |PFA3

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.