ARV1/YLR242C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXII: 623885 to 622920
CDS: 623885 - 622920

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ARV1 YLR242C ORF, Verified S000004232

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 1997-01-28. Gene name expires on 2000-07-21.
Description
Protein functioning in transport of glycosylphosphatidylinositol intermediates into the ER lumen; required for normal intracellular sterol distribution and for sphingolipid metabolism; similar to Nup120p and C. elegans R05H5.5 protein

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-09-05 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
intracellular sterol transport Tinkelenberg AH, et al. (2000) Mutations in yeast ARV1 alter intracellular sterol distribution and are complemented by human ARV1. J Biol Chem 275(52):40667-70
       IMP : Inferred from Mutant Phenotype
Assigned on 2009-05-07 SGD
lipid metabolic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0443
Assigned on 2009-10-01 UniProtKB
lipid transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0445
Assigned on 2007-05-23 UniProtKB
sphingolipid metabolic process Swain E, et al. (2002) Yeast cells lacking the ARV1 gene harbor defects in sphingolipid metabolism. Complementation by human ARV1. J Biol Chem 277(39):36152-60
       IMP : Inferred from Mutant Phenotype
Assigned on 2005-03-09 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0746
Assigned on 2007-05-23 UniProtKB
sterol metabolic process Sturley SL (2000) Conservation of eukaryotic sterol homeostasis: new insights from studies in budding yeast. Biochim Biophys Acta 1529(1-3):155-63
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2003-01-23 SGD
translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
Golgi apparatus Swain E, et al. (2002) Yeast cells lacking the ARV1 gene harbor defects in sphingolipid metabolism. Complementation by human ARV1. J Biol Chem 277(39):36152-60
       IDA : Inferred from Direct Assay
Assigned on 2003-01-23 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0333
Assigned on 2008-02-14 UniProtKB
endoplasmic reticulum Swain E, et al. (2002) Yeast cells lacking the ARV1 gene harbor defects in sphingolipid metabolism. Complementation by human ARV1. J Biol Chem 277(39):36152-60
       IDA : Inferred from Direct Assay
Assigned on 2003-01-23 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane Tinkelenberg AH, et al. (2000) Mutations in yeast ARV1 alter intracellular sterol distribution and are complemented by human ARV1. J Biol Chem 275(52):40667-70
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2002-09-05 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forARV1/YLR242C for ARV1
1) Tinkelenberg AH, et al. (2000) Mutations in yeast ARV1 alter intracellular sterol distribution and are complemented by human ARV1. J Biol Chem 275(52):40667-70

2) Swain E, et al. (2002) Yeast cells lacking the ARV1 gene harbor defects in sphingolipid metabolism. Complementation by human ARV1. J Biol Chem 277(39):36152-60

3) Kajiwara K, et al. (2008) Yeast ARV1 Is Required for Efficient Delivery of an Early GPI Intermediate to the First Mannosyltransferase during GPI Assembly and Controls Lipid Flow from the Endoplasmic Reticulum. Mol Biol Cell 19(5):2069-82

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ARV1/YLR242C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ARV1/YLR242C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MICITCM

C-term SGTYLLL

Length(aa) 321

MW(Da) 38,194

pI 9.59

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.059

Codon Adaptation Index 0.108

Frequency of Optimal Codons 0.387

Hydropathicity of Protein 0.327

Aromaticity Score 0.159

10 20 30 40 50 | | | | | MICITCMRPVDSLYTVYSNDHIQLTDCPYCQETVDKYVEIDNVLLFIDLL LLKAGAYRHLVFNALELHLSKYPKRKALNDCQCLRDYTQALLFNVKNWFC KYDRLNRLWLLLLSFEIYLTWVTEESKYIYYLNRNNNDGKLIMLSKKLPE SFKWDSAIMRNTITSKVFTWSPPIQYLYFASYCILDVSLFHTFTQYFILK KLHWKHYSVSSKDVISYTILLSYGAKIFPILMLIWPYDTLISMSIIKWVA NLYIIESLKIVTNLSYWNIIKIFISVSLLRYFMVKPILIVFVAKFNFSVI KNLIHQEFILLLQKSGTYLLL*

Protein Structures from PDB: proteins of known structure with sequence similarity to ARV1/YLR242C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
ARV1 2001-01-13 Tinkelenberg AH, et al. (2000) Mutations in yeast ARV1 alter intracellular sterol distribution and are complemented by human ARV1. J Biol Chem 275(52):40667-70

Standard Name	Date Standardized	Reference
ARV1	2001-01-13	*Tinkelenberg AH, et al.* (2000)** Mutations in yeast ARV1 alter intracellular sterol distribution and are complemented by human ARV1. J Biol Chem 275(52):40667-70

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YLR242C SGD Systematic Sequence

850943 NCBI: Gene ID

NP_013343.1 NCBI: RefSeq protein version ID

NP_013343.1 NCBI: RefSeq protein version ID

6323271 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YLR242C	SGD Systematic Sequence
850943	NCBI: Gene ID
NP_013343.1	NCBI: RefSeq protein version ID
NP_013343.1	NCBI: RefSeq protein version ID
6323271	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
24 curated references; 0 references not yet curated
Genetic Interactions
Mutants/Phenotypes
Hodg CA, et al. (2010) Integral membrane proteins Brr6 and Apq12 link assembly of the nuclear pore complex to lipid homeostasis in the endoplasmic reticulum. J Cell Sci 123(Pt 1):141-151
       |ACC1 |APQ12 |ARE1 |ARE2 |BRR6 |DGA1 |ELO1 |ERG2 |ERG3 |ERG4 |ERG5 |ERG6 |FEN1 |LRO1 |MORE
Reviews
Fujita M and Kinoshita T (2009) Structural remodeling of GPI anchors during biosynthesis and after attachment to proteins. FEBS Lett
     |BST1 |CDC1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |MORE
DNA/RNA Sequence Features
Reviews
Hood HM, et al. (2009) Evolutionary roles of upstream open reading frames in mediating gene regulation in fungi. Annu Rev Microbiol 63:385-409
       |APC2 |AVT2 |CAD1 |CBS1 |CLN3 |CPA1 |DCD1 |ECM7 |FOL1 |GCN4 |HAP4 |HEM3 |HOL1 |IMD4 |MORE
Genetic Interactions
Addinall SG, et al. (2008) A Genomewide Suppressor and Enhancer Analysis of cdc13-1 Reveals Varied Cellular Processes Influencing Telomere Capping in Saccharomyces cerevisiae. Genetics 180(4):2251-66
       |APQ12 |ARC18 |ASC1 |ASE1 |BFA1 |BIM1 |BMH1 |BRE2 |BUB1 |BUB2 |BUB3 |BUD27 |CCS1 |CCZ1 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Fei W, et al. (2008) Genome-wide analysis of sterol-lipid storage and trafficking in Saccharomyces cerevisiae. Eukaryot Cell 7(2):401-14
       |CAX4 |CDC50 |CNB1 |DRS2 |ERG3 |PLC1 |PTC1 |UME6 |VMA21 |VMA9
Reviews
Ikonen E and Jansen M (2008) Cellular sterol trafficking and metabolism: spotlight on structure. Curr Opin Cell Biol 20(4):371-7
       |PLC1 |PTC1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Kajiwara K, et al. (2008) Yeast ARV1 Is Required for Efficient Delivery of an Early GPI Intermediate to the First Mannosyltransferase during GPI Assembly and Controls Lipid Flow from the Endoplasmic Reticulum. Mol Biol Cell 19(5):2069-82
       |ERI1 |GAA1 |GAS1 |GPI15 |GPI2 |GWT1 |LAS21 |PMI40 |SPT14 |YPS1
Mutants/Phenotypes
Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90
       |ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ATG17 |ATP17 |BDF1 |BEM1 |BFR1 |MORE
Reviews
Ishtar Snoek IS and Yde Steensma H (2007) Factors involved in anaerobic growth of Saccharomyces cerevisiae. Yeast 24(1):1-10
       |ADH3 |ARG82 |BTS1 |CAX4 |CDC40 |CNM67 |DBP7 |DRS2 |FZO1 |GPD2 |GUP1 |HFI1 |HPR1 |IES2 |MORE
Mutants/Phenotypes
Thevissen K, et al. (2007) Miconazole Induces Changes in Actin Cytoskeleton prior to Reactive Oxygen Species Induction in Yeast. J Biol Chem 282(30):21592-7
       |ARO1 |ARO2 |CBF1 |CDC50 |CLC1 |CNB1 |CTR1 |DRS2 |FYV6 |GCN5 |GCS1 |HFI1 |HOF1 |NGG1 |MORE
Reviews
Dickson RC, et al. (2006) Functions and metabolism of sphingolipids in Saccharomyces cerevisiae. Prog Lipid Res 45(6):447-65
       |AUR1 |CSH1 |DPL1 |FEN1 |IPT1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |NCR1 |PKH1 |PKH2 |SCS7 |MORE
Cross-species Expression
Non-Fungal Related Genes/Proteins
Strains/Constructs
Fores O, et al. (2006) Arabidopsis thaliana expresses two functional isoforms of Arvp, a protein involved in the regulation of cellular lipid homeostasis. Biochim Biophys Acta 1761(7):725-35

Mutants/Phenotypes
Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401
       |AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARX1 |ATP12 |ATP2 |BEM1 |BUB3 |MORE
Fungal Related Genes/Proteins
Mutants/Phenotypes
Snoek IS and Steensma HY (2006) Why does Kluyveromyces lactis not grow under anaerobic conditions? Comparison of essential anaerobic genes of Saccharomyces cerevisiae with the Kluyveromyces lactis genome. FEMS Yeast Res 6(3):393-403
       |ACP1 |ARB1 |ARG82 |ARH1 |ATM1 |BTS1 |BUR6 |CAB2 |CAX4 |CDC40 |CNM67 |CTF4 |DBP7 |DRS2 |MORE
Protein-protein Interactions
Miller JP, et al. (2005) Large-scale identification of yeast integral membrane protein interactions. Proc Natl Acad Sci U S A 102(34):12123-8
       |EMP24 |EMP46 |EMP47 |ERD1 |ERD2 |ERG11 |ERP5 |ERV29 |ERV41 |MST27 |PHO84 |PHO88 |SEC61 |SHR3 |MORE
Function/Process
Genetic Interactions
Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19
           |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |BIG1 |MORE
DNA/RNA Sequence Features
Zhang Z and Dietrich FS (2005) Identification and characterization of upstream open reading frames (uORF) in the 5' untranslated regions (UTR) of genes in Saccharomyces cerevisiae. Curr Genet 48(2):77-87
         |APC2 |AVT2 |CPA1 |ECM7 |FOL1 |GCN4 |HAP4 |HEM3 |IMD4 |MBR1 |MKK1 |RPC11 |SLM2 |SPE4 |MORE
Mutants/Phenotypes
Strains/Constructs
Askree SH, et al. (2004) A genome-wide screen for Saccharomyces cerevisiae deletion mutants that affect telomere length. Proc Natl Acad Sci U S A 101(23):8658-63
           |ADE12 |ADO1 |AGP2 |APE3 |ARG2 |ASC1 |ATG11 |BEM4 |BRE2 |BRO1 |BUD16 |BUD30 |CAX4 |CCW14 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Beh CT and Rine J (2004) A role for yeast oxysterol-binding protein homologs in endocytosis and in the maintenance of intracellular sterol-lipid distribution. J Cell Sci 117(Pt 14):2983-96
       |ERG9 |HES1 |KES1 |OSH2 |OSH3 |OSH6 |OSH7 |SLA2 |SWH1
Genetic Interactions
Strains/Constructs
Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9
           |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |BUD25 |CAX4 |CHO2 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |CNB1 |MORE
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Cellular Location
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Swain E, et al. (2002) Yeast cells lacking the ARV1 gene harbor defects in sphingolipid metabolism. Complementation by human ARV1. J Biol Chem 277(39):36152-60

Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Sturley SL (2000) Conservation of eukaryotic sterol homeostasis: new insights from studies in budding yeast. Biochim Biophys Acta 1529(1-3):155-63
       |ARE1 |ARE2 |ARH1 |ECM22 |ERG10 |ERG11 |ERG6 |ERG9 |HMG1 |HMG2 |HMS1 |LRO1 |NCR1 |ROX1 |MORE
Cross-species Expression
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Strains/Constructs
Tinkelenberg AH, et al. (2000) Mutations in yeast ARV1 alter intracellular sterol distribution and are complemented by human ARV1. J Biol Chem 275(52):40667-70
       |ARE1 |ARE2

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.