ERG27/YLR100W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXII: 341811 to 342854
CDS: 341811 - 342854

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ERG27 YLR100W ORF, Verified S000004090

Description
3-keto sterol reductase, catalyzes the last of three steps required to remove two C-4 methyl groups from an intermediate in ergosterol biosynthesis; mutants are sterol auxotrophs

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
3-keto sterol reductase activity Gachotte D, et al. (1999) Characterization of the Saccharomyces cerevisiae ERG27 gene encoding the 3-keto reductase involved in C-4 sterol demethylation. Proc Natl Acad Sci U S A 96(22):12655-60
       IMP : Inferred from Mutant Phenotype
Assigned on 2001-01-18 SGD
GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
     IEA : Inferred from Electronic Annotation with IUBMB:1.1.1.270
Assigned on 2009-11-20 UniProtKB
binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR016040
Assigned on 2008-02-13 UniProtKB
catalytic activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR016040
Assigned on 2008-02-13 UniProtKB
oxidoreductase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR002198
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0560
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
alcohol metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
cellular metabolic compound salvage Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
ergosterol biosynthetic process Gachotte D, et al. (1999) Characterization of the Saccharomyces cerevisiae ERG27 gene encoding the 3-keto reductase involved in C-4 sterol demethylation. Proc Natl Acad Sci U S A 96(22):12655-60
       IMP : Inferred from Mutant Phenotype
Assigned on 2001-01-18 SGD
lipid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0444
Assigned on 2007-05-23 UniProtKB
metabolic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR002198 , EBI:IPR016040
Assigned on 2007-05-23 UniProtKB
oxidation reduction GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0560
Assigned on 2008-05-21 UniProtKB
steroid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0752
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Baudry K, et al. (2001) The effect of the erg26-1 mutation on the regulation of lipid metabolism in Saccharomyces cerevisiae. J Biol Chem 276(16):12702-11
       IDA : Inferred from Direct Assay
Assigned on 2002-06-30 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
endoplasmic reticulum membrane Mo C, et al. (2002) Protein-protein interactions among C-4 demethylation enzymes involved in yeast sterol biosynthesis. Proc Natl Acad Sci U S A 99(15):9739-44
       IDA : Inferred from Direct Assay
Assigned on 2002-08-19 SGD
extrinsic to membrane GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9903
Assigned on 2009-10-01 UniProtKB
lipid particle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0551
Assigned on 2008-02-14 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
mitochondrial outer membrane Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50
         IDA : Inferred from Direct Assay
Assigned on 2006-03-17 SGD
monolayer-surrounded lipid storage body GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0154
Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
ergosterol biosynthesis

Summary Paragraph [TOP] [NEXT]
SUMMARY PARAGRAPH for ERG27/YLR100W for ERG27
ERG27 encodes 3-keto sterol reductase, an enzyme that catalyzes the last of three steps required to remove two C-4 methyl groups from an intermediate in ergosterol biosynthesis (1, 2, 3, 4). Cells lacking ERG27 are sterol auxotrophs, and accumulate noncyclic sterol intermediates when grown in the presence of sterols (1).
Last Updated: 2000-09-01

Basic References [TOP]
BASIC INFORMATION REFERENCES forERG27/YLR100W for ERG27
1) Gachotte D, et al. (1999) Characterization of the Saccharomyces cerevisiae ERG27 gene encoding the 3-keto reductase involved in C-4 sterol demethylation. Proc Natl Acad Sci U S A 96(22):12655-60

2) Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press

3) Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6

4) Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERG27/YLR100W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERG27/YLR100W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MNRKVAI

C-term VETRTPI

Length(aa) 347

MW(Da) 39,724

pI 8.9

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.091

Codon Adaptation Index 0.140

Frequency of Optimal Codons 0.473

Hydropathicity of Protein -0.119

Aromaticity Score 0.127

10 20 30 40 50 | | | | | MNRKVAIVTGTNSNLGLNIVFRLIETEDTNVRLTIVVTSRTLPRVQEVIN QIKDFYNKSGRVEDLEIDFDYLLVDFTNMVSVLNAYYDINKKYRAINYLF VNAAQGIFDGIDWIGAVKEVFTNPLEAVTNPTYKIQLVGVKSKDDMGLIF QANVFGPYYFISKILPQLTRGKAYIVWISSIMSDPKYLSLNDIELLKTNA SYEGSKRLVDLLHLATYKDLKKLGINQYVVQPGIFTSHSFSEYLNFFTYF GMLCLFYLARLLGSPWHNIDGYKAANAPVYVTRLANPNFEKQDVKYGSAT SRDGMPYIKTQEIDPTGMSDVFAYIQKKKLEWDEKLKDQIVETRTPI*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERG27/YLR100W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
ERG27 SGD (2007) Information without a citation in SGD

Standard Name	Reference
ERG27	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YLR100W SGD Systematic Sequence

850790 NCBI: Gene ID

NP_013201.1 NCBI: RefSeq protein version ID

NP_013201.1 NCBI: RefSeq protein version ID

6323129 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YLR100W	SGD Systematic Sequence
850790	NCBI: Gene ID
NP_013201.1	NCBI: RefSeq protein version ID
NP_013201.1	NCBI: RefSeq protein version ID
6323129	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
26 curated references; 0 references not yet curated
Mutants/Phenotypes
Strains/Constructs
Taramino S, et al. (2010) Interactions of oxidosqualene cyclase (Erg7p) with 3-keto reductase (Erg27p) and other enzymes of sterol biosynthesis in yeast. Biochim Biophys Acta 1801(2):156-162
     |ERG25 |ERG26 |ERG7
Regulation of
Zeng T and Li J (2010) Maximization of negative correlations in time-course gene expression data for enhancing understanding of molecular pathways. Nucleic Acids Res 38(1):e1
       |ACO2 |ADR1 |CAB2 |CAT8 |CIT1 |ERG2 |ERG26 |ERG4 |ERG5 |ERG6 |GCN4 |GTT1 |HAP1 |HAP3 |MORE
Reviews
Goodman JM (2009) Demonstrated and inferred metabolism associated with cytosolic lipid droplets. J Lipid Res 50(11):2148-56
       |AYR1 |DGA1 |EHT1 |ERG1 |ERG26 |ERG6 |ERG7 |FAA1 |FAA4 |FAT1 |SLC1 |TGL1 |TGL3 |TGL4 |MORE
Evolution
Non-Fungal Related Genes/Proteins
Reviews
Mindnich R and Adamski J (2009) Zebrafish 17beta-hydroxysteroid dehydrogenases: An evolutionary perspective. Mol Cell Endocrinol 301(1-2):20-6
       |IFA38
Regulation of
Transcription
Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461
       |AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
RNA Levels and Processing
Regulation of
Guo N, et al. (2008) Global gene expression profile of Saccharomyces cerevisiae induced by dictamnine. Yeast 25(9):631-41
       |ADE1 |ADE12 |ADE13 |ADE16 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADE8 |ADY2 |APT1 |CBF1 |CIS3 |MORE
Protein-protein Interactions
Huthmacher C, et al. (2008) A computational analysis of protein interactions in metabolic networks reveals novel enzyme pairs potentially involved in metabolic channeling. J Theor Biol 252(3):456-64
       |ACC1 |ADE3 |ALD6 |APA1 |APA2 |ARO1 |ARO10 |CDC19 |CHA1 |CHO1 |ERG25 |FAS1 |FAS2 |GDH1 |MORE
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Protein Processing/Modification/Regulation
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Substrates/Ligands/Cofactors
Teske B, et al. (2008) Genetic analyses involving interactions between the ergosterol biosynthetic enzymes, lanosterol synthase (Erg7p) and 3-ketoreductase (Erg27p), in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1781(8):359-66
       |ERG7
Genomic expression study
Large-scale protein detection
Castrillo JI, et al. (2007) Growth control of the eukaryote cell: a systems biology study in yeast. J Biol 6(2):4
       |ACO1 |ACO2 |ADH4 |ADO1 |ALD5 |ARG8 |CDC33 |CPA1 |CPA2 |DDI1 |DPP1 |ENO1 |ERG1 |ERO1 |MORE
Reviews
Schulz TA and Prinz WA (2007) Sterol transport in yeast and the oxysterol binding protein homologue (OSH) family. Biochim Biophys Acta 1771(6):769-80
       |AUS1 |CAT5 |DAN1 |ERG1 |ERG11 |ERG3 |ERG5 |ERG6 |ERG7 |HES1 |KES1 |MGM101 |NCR1 |NPC2 |MORE
Fungal Related Genes/Proteins
Mutants/Phenotypes
Snoek IS and Steensma HY (2006) Why does Kluyveromyces lactis not grow under anaerobic conditions? Comparison of essential anaerobic genes of Saccharomyces cerevisiae with the Kluyveromyces lactis genome. FEMS Yeast Res 6(3):393-403
       |ACP1 |ARB1 |ARG82 |ARH1 |ARV1 |ATM1 |BTS1 |BUR6 |CAB2 |CAX4 |CDC40 |CNM67 |CTF4 |DBP7 |MORE
Cellular Location
Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50
         |AFG1 |AIM18 |ALD4 |ALO1 |ATP15 |ATP2 |ATP3 |ATP5 |AYR1 |BNA4 |CBR1 |CIR1 |COR1 |CYB2 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Altmann K and Westermann B (2005) Role of essential genes in mitochondrial morphogenesis in Saccharomyces cerevisiae. Mol Biol Cell 16(11):5410-7
           |ARC35 |ARC40 |ARP2 |BFR2 |CCT4 |CCT6 |CDC34 |CDC53 |COF1 |DSL1 |ERG1 |ERG10 |ERG12 |ERG13 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52
           |ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
Protein-protein Interactions
Techniques and Reagents
Mo C and Bard M (2005) A systematic study of yeast sterol biosynthetic protein-protein interactions using the split-ubiquitin system. Biochim Biophys Acta 1737(2-3):152-60
       |ERG1 |ERG11 |ERG2 |ERG24 |ERG25 |ERG26 |ERG28 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG9
Protein-protein Interactions
Mo C and Bard M (2005) Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex. J Lipid Res 46(9):1991-8
       |ERG1 |ERG11 |ERG25 |ERG26 |ERG28 |ERG6
RNA Levels and Processing
Regulation of
Jones DL, et al. (2004) Genome-Wide Analysis of the Effects of Heat Shock on a Saccharomyces cerevisiae Mutant With a Constitutively Activated cAMP-Dependent Pathway. Comp Funct Genomics 5(5):419-31
               |BTN2 |COX6 |DCS1 |ENO1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG26 |ERG3 |ERG6 |MORE
RNA Levels and Processing
Techniques and Reagents
Krantz M, et al. (2004) Anaerobicity prepares Saccharomyces cerevisiae cells for faster adaptation to osmotic shock. Eukaryot Cell 3(6):1381-90
           |ALD2 |ALD3 |ALD4 |ALD6 |CTT1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |MORE
Fungal Related Genes/Proteins
Pierson CA, et al. (2004) Isolation, characterization, and regulation of the Candida albicans ERG27 gene encoding the sterol 3-keto reductase. Med Mycol 42(5):461-73

Cross-species Expression
Non-Fungal Related Genes/Proteins
Marijanovic Z, et al. (2003) Closing the gap: identification of human 3-ketosteroid reductase, the last unknown enzyme of mammalian cholesterol biosynthesis. Mol Endocrinol 17(9):1715-25

Cellular Location
Function/Process
Mutants/Phenotypes
Protein-protein Interactions
Regulatory Role
Strains/Constructs
Mo C, et al. (2003) In yeast sterol biosynthesis the 3-keto reductase protein (Erg27p) is required for oxidosqualene cyclase (Erg7p) activity. Biochim Biophys Acta 1633(1):68-74
     |ERG7
Cellular Location
Function/Process
Mutants/Phenotypes
Protein Physical Properties
Protein-protein Interactions
Strains/Constructs
Mo C, et al. (2002) Protein-protein interactions among C-4 demethylation enzymes involved in yeast sterol biosynthesis. Proc Natl Acad Sci U S A 99(15):9739-44
       |ERG25 |ERG26 |ERG28
Cellular Location
Function/Process
Protein-protein Interactions
Strains/Constructs
Baudry K, et al. (2001) The effect of the erg26-1 mutation on the regulation of lipid metabolism in Saccharomyces cerevisiae. J Biol Chem 276(16):12702-11
       |ERG25 |ERG26 |FEN1 |SUR4
Function/Process
Other Features
Gachotte D, et al. (2001) A novel gene conserved from yeast to humans is involved in sterol biosynthesis. J Lipid Res 42(1):150-4
       |ERG26 |ERG28
Protein-protein Interactions
Seol JH, et al. (2001) Skp1 forms multiple protein complexes, including RAVE, a regulator of V-ATPase assembly. Nat Cell Biol 3(4):384-91
       |BDF1 |CDC4 |CDC53 |CDC7 |CEP3 |CTF13 |DAS1 |DCN1 |EFT2 |GRR1 |HRT1 |HRT3 |MDM30 |MET30 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Gachotte D, et al. (1999) Characterization of the Saccharomyces cerevisiae ERG27 gene encoding the 3-keto reductase involved in C-4 sterol demethylation. Proc Natl Acad Sci U S A 96(22):12655-60
       |ERG25 |ERG26

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.