GAA1/YLR088W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXII: 316108 to 317952
CDS: 316108 - 317952

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

GAA1 YLR088W END2 ORF, Verified S000004078

Description
Subunit of the GPI (glycosylphosphatidylinositol):protein transamidase complex, removes the GPI-anchoring signal and attaches GPI to proteins in the ER

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
GPI-anchor transamidase activity Fraering P, et al. (2001) The GPI transamidase complex of Saccharomyces cerevisiae contains Gaa1p, Gpi8p, and Gpi16p. Mol Biol Cell 12(10):3295-306
       IPI : Inferred from Physical Interaction
IMP : Inferred from Mutant Phenotype
Assigned on 2002-07-24 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
GPI anchor biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0337
Assigned on 2007-05-23 UniProtKB
attachment of GPI anchor to protein Fraering P, et al. (2001) The GPI transamidase complex of Saccharomyces cerevisiae contains Gaa1p, Gpi8p, and Gpi16p. Mol Biol Cell 12(10):3295-306
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-07-24 SGD
lipoprotein metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
GPI-anchor transamidase complex Fraering P, et al. (2001) The GPI transamidase complex of Saccharomyces cerevisiae contains Gaa1p, Gpi8p, and Gpi16p. Mol Biol Cell 12(10):3295-306
       IPI : Inferred from Physical Interaction
Assigned on 2005-02-09 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007246
Assigned on 2007-05-23 UniProtKB
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007246
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forGAA1/YLR088W for GAA1
1) Chvatchko Y, et al. (1986) Two yeast mutants defective in endocytosis are defective in pheromone response. Cell 46(3):355-64

2) Fraering P, et al. (2001) The GPI transamidase complex of Saccharomyces cerevisiae contains Gaa1p, Gpi8p, and Gpi16p. Mol Biol Cell 12(10):3295-306

3) Hamburger D, et al. (1995) Yeast Gaa1p is required for attachment of a completed GPI anchor onto proteins. J Cell Biol 129(3):629-39

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for GAA1/YLR088W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for GAA1/YLR088W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MALLEKL

C-term RSKEKQS

Length(aa) 614

MW(Da) 69,220

pI 6.21

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.048

Codon Adaptation Index 0.121

Frequency of Optimal Codons 0.424

Hydropathicity of Protein 0.258

Aromaticity Score 0.119

10 20 30 40 50 | | | | | MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRR TYISENALMPSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSW LQEFGTKTAIYENEQYGETLYGVMHAPRGDGTEAMVLAVPWFNSDDEFNI GGAALGVSLARFFSRWPVWSKNIIVVFSENPRAALRSWVEAYHTSLDLTG GSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNIAISITEHEGM KVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQ FVSISSYLPSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFV SLVISFVVSQAFLLIPSSGLLMTISMASCFLPLILSRKIHISEPLSYRLK NVAFLYFSLVSTSLLMINFAMALLIGTLAFPMTFVKTIVESSSEHEVTTQ SSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLVLLILTNPFISIT LFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASSF ESKSVVVRSKEKQS*

Protein Structures from PDB: proteins of known structure with sequence similarity to GAA1/YLR088W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
GAA1 Hamburger D, et al. (1995) Yeast Gaa1p is required for attachment of a completed GPI anchor onto proteins. J Cell Biol 129(3):629-39

Alias Name(s) Reference
END2 Chvatchko Y, et al. (1986) Two yeast mutants defective in endocytosis are defective in pheromone response. Cell 46(3):355-64

Standard Name	Reference
GAA1	*Hamburger D, et al.* (1995)** Yeast Gaa1p is required for attachment of a completed GPI anchor onto proteins. J Cell Biol 129(3):629-39

Alias Name(s)	Reference
END2	*Chvatchko Y, et al.* (1986)** Two yeast mutants defective in endocytosis are defective in pheromone response. Cell 46(3):355-64

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YLR088W SGD Systematic Sequence

850777 NCBI: Gene ID

NP_013189.1 NCBI: RefSeq protein version ID

NP_013189.1 NCBI: RefSeq protein version ID

6323117 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YLR088W	SGD Systematic Sequence
850777	NCBI: Gene ID
NP_013189.1	NCBI: RefSeq protein version ID
NP_013189.1	NCBI: RefSeq protein version ID
6323117	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
27 curated references; 0 references not yet curated
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
He X, et al. (2010) Prevalent positive epistasis in Escherichia coli and Saccharomyces cerevisiae metabolic networks. Nat Genet
       |ACT1 |ALG7 |AVO1 |CCT2 |CHO2 |EOS1 |GAS1 |GUK1 |MET22 |NUP60 |NUS1 |RPC10 |RPL14A |RPS5 |MORE
Reviews
Fujita M and Kinoshita T (2009) Structural remodeling of GPI anchors during biosynthesis and after attachment to proteins. FEBS Lett
     |ARV1 |BST1 |CDC1 |CWH43 |ERI1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |MORE
Mutants/Phenotypes
Strains/Constructs
Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
       |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Kajiwara K, et al. (2008) Yeast ARV1 Is Required for Efficient Delivery of an Early GPI Intermediate to the First Mannosyltransferase during GPI Assembly and Controls Lipid Flow from the Endoplasmic Reticulum. Mol Biol Cell 19(5):2069-82
       |ARV1 |ERI1 |GAS1 |GPI15 |GPI2 |GWT1 |LAS21 |PMI40 |SPT14 |YPS1
Reviews
Bosson R and Conzelmann A (2007) Multiple functions of inositolphosphorylceramides in the formation and intracellular transport of glycosylphosphatidylinositol-anchored proteins in yeast. Biochem Soc Symp (74):199-209
     |BST1 |ERI1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |GPI19 |MORE
Reviews
Orlean P and Menon AK (2007) Thematic review series: lipid posttranslational modifications. GPI anchoring of protein in yeast and mammalian cells, or: how we learned to stop worrying and love glycophospholipids. J Lipid Res 48(5):993-1011
         |BST1 |CWH43 |ERI1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Reviews
Pittet M and Conzelmann A (2007) Biosynthesis and function of GPI proteins in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):405-20
       |BST1 |CWH43 |ERI1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Cellular Location
Mutants/Phenotypes
Protein Processing/Modification/Regulation
Protein-protein Interactions
Strains/Constructs
Techniques and Reagents
Zhu Y, et al. (2005) Gpi17p does not stably interact with other subunits of glycosylphosphatidylinositol transamidase in Saccharomyces cerevisiae. Biochim Biophys Acta 1735(1):79-88
       |GPI16 |GPI17 |GPI8
Function/Process
Genetic Interactions
Mutants/Phenotypes
Grimme SJ, et al. (2004) Deficiencies in the endoplasmic reticulum (ER)-membrane protein Gab1p perturb transfer of glycosylphosphatidylinositol to proteins and cause perinuclear ER-associated actin bar formation. Mol Biol Cell 15(6):2758-70
       |ACT1 |GAB1 |GPI16 |GPI17 |GPI8
Non-Fungal Related Genes/Proteins
Hong Y, et al. (2003) Human PIG-U and yeast Cdc91p are the fifth subunit of GPI transamidase that attaches GPI-anchors to proteins. Mol Biol Cell 14(5):1780-9
     |GAB1 |GPI8
Non-Fungal Related Genes/Proteins
Nagamune K, et al. (2003) GPI transamidase of Trypanosoma brucei has two previously uncharacterized (trypanosomatid transamidase 1 and 2) and three common subunits. Proc Natl Acad Sci U S A 100(19):10682-7
     |GPI16 |GPI8
Non-Fungal Related Genes/Proteins
Delorenzi M, et al. (2002) Genes for glycosylphosphatidylinositol toxin biosynthesis in Plasmodium falciparum. Infect Immun 70(8):4510-22
         |DPM1 |GPI1 |GPI10 |GPI12 |GPI13 |GPI14 |GPI8 |SPT14
Cellular Location
Function/Process
Protein-protein Interactions
Fraering P, et al. (2001) The GPI transamidase complex of Saccharomyces cerevisiae contains Gaa1p, Gpi8p, and Gpi16p. Mol Biol Cell 12(10):3295-306
       |GPI16 |GPI8 |SEC61
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Grimme SJ, et al. (2001) The essential Smp3 protein is required for addition of the side-branching fourth mannose during assembly of yeast glycosylphosphatidylinositols. J Biol Chem 276(29):27731-9
       |ALG12 |ALG9 |GPI1 |GPI10 |GPI11 |GPI13 |SMP3
Function/Process
Non-Fungal Related Genes/Proteins
Ohishi K, et al. (2001) PIG-S and PIG-T, essential for GPI anchor attachment to proteins, form a complex with GAA1 and GPI8. EMBO J 20(15):4088-98
       |GPI16 |GPI17 |GPI8
Non-Fungal Related Genes/Proteins
Vidugiriene J, et al. (2001) Endoplasmic reticulum proteins involved in glycosylphosphatidylinositol-anchor attachment: photocrosslinking studies in a cell-free system. Eur J Biochem 268(8):2290-300
             |GPI8
Function/Process
Reviews
Kinoshita T and Inoue N (2000) Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis. Curr Opin Chem Biol 4(6):632-8
       |DPM1 |GPI1 |GPI10 |GPI13 |GPI14 |GPI19 |GPI2 |GPI8 |LAS21 |MCD4 |SMP3 |SPT14
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Meyer U, et al. (2000) Active site determination of Gpi8p, a caspase-related enzyme required for glycosylphosphatidylinositol anchor addition to proteins. Biochemistry 39(12):3461-71
       |GAS1 |GPI8
Non-Fungal Related Genes/Proteins
Strains/Constructs
Ohishi K, et al. (2000) Gaa1p and gpi8p are components of a glycosylphosphatidylinositol (GPI) transamidase that mediates attachment of GPI to proteins. Mol Biol Cell 11(5):1523-33
       |GPI8
Non-Fungal Related Genes/Proteins
Inoue N, et al. (1999) Human and mouse GPAA1 (Glycosylphosphatidylinositol anchor attachment 1) genes: genomic structures, chromosome loci and the presence of a minor class intron. Cytogenet Cell Genet 84(3-4):199-205

Function/Process
Mutants/Phenotypes
Strains/Constructs
Mazhari-Tabrizi R, et al. (1999) Chromosomal promoter replacement in Saccharomyces cerevisiae: construction of conditional lethal strains for the cloning of glycosyltransferases from various organisms. Glycoconj J 16(11):673-9
     |ALG1 |ALG7 |DPM1 |GPI2 |PIS1 |SEC59 |SPT14 |WBP1
Non-Fungal Related Genes/Proteins
Hiroi Y, et al. (1998) Molecular cloning of human homolog of yeast GAA1 which is required for attachment of glycosylphosphatidylinositols to proteins. FEBS Lett 421(3):252-8

Mutants/Phenotypes
Benghezal M, et al. (1995) Identification of six complementation classes involved in the biosynthesis of glycosylphosphatidylinositol anchors in Saccharomyces cerevisiae. J Cell Biol 130(6):1333-44
     |GAS1 |GPI4 |GPI5 |GPI6 |GPI8 |GPI9 |LAS21 |SAG1
Cellular Location
Function/Process
Mutants/Phenotypes
Strains/Constructs
Hamburger D, et al. (1995) Yeast Gaa1p is required for attachment of a completed GPI anchor onto proteins. J Cell Biol 129(3):629-39
     |GAS1
Reviews
Takeda J and Kinoshita T (1995) GPI-anchor biosynthesis. Trends Biochem Sci 20(9):367-71
       |SPT14
Function/Process
Other Features
Douglas CM, et al. (1988) Role of protein processing, intracellular trafficking and endocytosis in production of and immunity to yeast killer toxin. Eur J Epidemiol 4(4):400-8
     |KEX1 |KEX2 |PEP12 |PEP5 |PHO5 |VPS3
Cellular Location
Function/Process
Mutants/Phenotypes
Strains/Constructs
Chvatchko Y, et al. (1986) Two yeast mutants defective in endocytosis are defective in pheromone response. Cell 46(3):355-64
       |PEP5

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.