---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

RAX2/YLR084C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXII: 300252 to 296590 CDS: 300252 - 296590 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
RAX2	YLR084C		ORF, Verified	S000004074
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 1999-08-24. Gene name expires on 2000-08-24.
Description
N-glycosylated protein involved in the maintenance of bud site selection during bipolar budding; localization requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2002-10-01 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0131 Assigned on 2007-05-23 UniProtKB cell division GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0132 Assigned on 2007-05-23 UniProtKB Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular bud site selection Chen T, et al. (2000) Multigenerational cortical inheritance of the Rax2 protein in orienting polarity and division in yeast. Science 290(5498):1975-8        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction Assigned on 2002-09-30 SGD cofactor transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT regulation of signal transduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cellular bud neck Chen T, et al. (2000) Multigenerational cortical inheritance of the Rax2 protein in orienting polarity and division in yeast. Science 290(5498):1975-8        IDA : Inferred from Direct Assay Assigned on 2001-05-25 SGD Kang PJ, et al. (2004) Interactions among Rax1p, Rax2p, Bud8p, and Bud9p in marking cortical sites for bipolar bud-site selection in yeast. Mol Biol Cell 15(11):5145-57        IDA : Inferred from Direct Assay Assigned on 2004-12-09 SGD GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0029 Assigned on 2008-02-13 UniProtKB cellular bud scar Chen T, et al. (2000) Multigenerational cortical inheritance of the Rax2 protein in orienting polarity and division in yeast. Science 290(5498):1975-8        IDA : Inferred from Direct Assay Assigned on 2002-09-30 SGD cellular bud tip GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0030 Assigned on 2008-02-13 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9905 Assigned on 2009-10-01 UniProtKB membrane Chen T, et al. (2000) Multigenerational cortical inheritance of the Rax2 protein in orienting polarity and division in yeast. Science 290(5498):1975-8        ISS : Inferred from Sequence or structural Similarity Assigned on 2002-09-30 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12          IDA : Inferred from Direct Assay Assigned on 2004-12-03 SGD Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD plasma membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-1003 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forRAX2/YLR084C for RAX2 1) Chen T, et al. (2000) Multigenerational cortical inheritance of the Rax2 protein in orienting polarity and division in yeast. Science 290(5498):1975-8        2) Kang PJ, et al. (2004) Interactions among Rax1p, Rax2p, Bud8p, and Bud9p in marking cortical sites for bipolar bud-site selection in yeast. Mol Biol Cell 15(11):5145-57        3) Seay D, et al. (2006) A three-hybrid screen identifies mRNAs controlled by a regulatory protein. RNA 12(8):1594-600

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for RAX2/YLR084C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for RAX2/YLR084C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MFVHRLW C-term EKLMKFV Length(aa) 1,220 MW(Da) 133,958 pI 4.26 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.018   Codon Adaptation Index 0.122   Frequency of Optimal Codons 0.422   Hydropathicity of Protein -0.165   Aromaticity Score 0.106

10 20 30 40 50 | | | | | MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAV QILGGVDALSFYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDD TRIDKITPFGVDSFILSGSGTINNISVGNQILYNLSTLSMTPIFNQSLGA VQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPFGGFGEN SSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNSTSSLNATTLEL GQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYE VSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEF CPLYSRATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPV SSLKFVALNSYGGSVGLSGLELYQDTFSTYANDSLNEYGCSALTNDSSSS TLSSNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGHYTINMYT PGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYL DFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKE TLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDN KLVIGGVSNRISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDI LSSNNQSAVFLFNGSFENVFNQSRTVNSALNISLANNDFIVLDNDYVVNA SSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLNGSVRFLNE NEIEPLNLEGGIVPYLGAYLNESATAYAYEVDSLNKIYFSNEVYPSWNWS SGITQMLYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARIN ALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEIT QLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSF TVTEDSIVAWNDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTL NKRGINNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTS NYNPIIFINRDVSTEFNSQSPLANVNITVTSPQSTSSQPPSSSASSESKS KSKKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKP RIDENEMLDTVPPEKLMKFV*

Protein Structures from PDB: proteins of known structure with sequence similarity to RAX2/YLR084C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
RAX2	2001-05-18	Chen T, et al. (2000) Multigenerational cortical inheritance of the Rax2 protein in orienting polarity and division in yeast. Science 290(5498):1975-8

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YLR084C	SGD Systematic Sequence
850773	NCBI: Gene ID
NP_013185.1	NCBI: RefSeq protein version ID
NP_013185.1	NCBI: RefSeq protein version ID
6323113	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
16 curated references; 0 references not yet curated
Reviews	Slaughter BD, et al. (2009) Symmetry breaking in the life cycle of the budding yeast. Cold Spring Harbor Perspect Biol 1(3):a003384	|AXL1 |AXL2 |BEM1 |BNI1 |BNR1 |BUD2 |BUD3 |BUD4 |BUD5 |BUD8 |BUD9 |CDC24 |CDC42 |FAR1 |MORE
Fungal Related Genes/Proteins	Banuett F, et al. (2008) The machinery for cell polarity, cell morphogenesis, and the cytoskeleton in the Basidiomycete fungus Ustilago maydis-a survey of the genome sequence. Fungal Genet Biol 45 Suppl 1:S3-S14	|ABP1 |ACT1 |ARP1 |ARP10 |ARP2 |ARP3 |AXL2 |BEM1 |BIK1 |BIM1 |BNI1 |BUD6 |CDC10 |CDC11 |MORE
Reviews	Lengeler KB, et al. (2008) Protein-O-mannosyltransferases in virulence and development. Cell Mol Life Sci 65(4):528-44	|AGA1 |AGA2 |AXL2 |BAR1 |CIS3 |CTS1 |FUS1 |GAS1 |HSP150 |KEX2 |KRE9 |MID2 |PIR1 |PIR3 |MORE
Reviews	Park HO and Bi E (2007) Central roles of small GTPases in the development of cell polarity in yeast and beyond. Microbiol Mol Biol Rev 71(1):48-96	|ACT1 |AXL1 |AXL2 |BEM1 |BEM2 |BEM3 |BNI1 |BUD2 |BUD3 |BUD4 |BUD5 |BUD8 |BUD9 |CDC10 |MORE
Fungal Related Genes/Proteins	Choi E, et al. (2006) Function of rax2p in the Polarized Growth of Fission Yeast. Mol Cells 22(2):146-53
Regulation of Transcription	Purevdorj-Gage B, et al. (2006) Effects of low-shear modeled microgravity on cell function, gene expression, and phenotype in Saccharomyces cerevisiae. Appl Environ Microbiol 72(7):4569-75	|BUD25 |BUD5 |DSE1 |DSE2 |DSE4 |EGT2 |RAX1
Cellular Location	Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Cell Cycle Phase Involved DNA/RNA Sequence Features RNA Levels and Processing Regulation of Strains/Constructs	Seay D, et al. (2006) A three-hybrid screen identifies mRNAs controlled by a regulatory protein. RNA 12(8):1594-600	|ASE1 |CIN8 |LPD1 |MPT5 |SWD3 |UTR1
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Kang PJ, et al. (2004) Interactions among Rax1p, Rax2p, Bud8p, and Bud9p in marking cortical sites for bipolar bud-site selection in yeast. Mol Biol Cell 15(11):5145-57	|BUD8 |BUD9 |RAX1
DNA/RNA Sequence Features Regulation of	Kreiman G (2004) Identification of sparsely distributed clusters of cis-regulatory elements in sets of co-expressed genes. Nucleic Acids Res 32(9):2889-900	|ACE2 |AIM20 |ALK1 |APC1 |BUD3 |BUD4 |BUD8 |CDC20 |CDC5 |CHS2 |CLB1 |CLB2 |HOF1 |HST3 |MORE
Cellular Location	Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
Regulation of	Zeitlinger J, et al. (2003) Program-specific distribution of a transcription factor dependent on partner transcription factor and MAPK signaling. Cell 113(3):395-404	|ACT1 |ADE1 |AFR1 |AGA1 |ASG7 |BEM1 |BEM2 |BMH1 |BUD14 |BUD8 |CHS1 |CHS7 |CIK1 |CLA4 |MORE
Protein-protein Interactions	Subba Rao G, et al. (2002) Two-hybrid-based analysis of protein-protein interactions of the yeast multidrug resistance protein, Pdr5p. Funct Integr Genomics 1(6):357-66	|ECM27 |HKR1 |NRT1 |OTU1 |PDR5 |PRY3 |SCP160 |TMS1 |UTP10 |YAP3 |YPL136W
DNA/RNA Sequence Features Regulation of Transcription	Iyer VR, et al. (2001) Genomic binding sites of the yeast cell-cycle transcription factors SBF and MBF. Nature 409(6819):533-8	|ABF1 |APN1 |BBP1 |BUD9 |CAP1 |CDC21 |CDC45 |CDC7 |CLA4 |CLB1 |CLB2 |CLB6 |CLD1 |CLN1 |MORE
Cell Cycle Phase Involved RNA Levels and Processing Regulation of	Simon I, et al. (2001) Serial regulation of transcriptional regulators in the yeast cell cycle. Cell 106(6):697-708	|ACE2 |AGA1 |AGA2 |ALK1 |APC1 |ARP7 |ASH1 |BUD4 |BUD8 |BUD9 |CDC20 |CDC21 |CDC45 |CDC6 |MORE
Cell Cycle Phase Involved Cellular Location Function/Process Mutants/Phenotypes RNA Levels and Processing Strains/Constructs	Chen T, et al. (2000) Multigenerational cortical inheritance of the Rax2 protein in orienting polarity and division in yeast. Science 290(5498):1975-8	|RAX1

Return to SGD

Send a Message to the SGD Curators