BUD20/YLR074C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXII: 282457 to 281957
CDS: 282457 - 281957

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

BUD20 YLR074C ORF, Verified S000004064

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2001-02-13. Gene name expires on 2002-02-13.
Description
Protein involved in bud-site selection; diploid mutants display a random budding pattern instead of the wild-type bipolar pattern

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
metal ion binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0479
Assigned on 2007-05-23 UniProtKB
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2001-02-13 SGD
nucleic acid binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003604
Assigned on 2008-05-01 UniProtKB
zinc ion binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003604 , EBI:IPR007087 , EBI:IPR015880
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0862
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cellular bud site selection Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-10 SGD
ribosomal large subunit biogenesis Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0095
Assigned on 2008-02-13 UniProtKB
intracellular DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007087 , EBI:IPR015880
Assigned on 2007-05-23 UniProtKB
nucleus Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       IDA : Inferred from Direct Assay
Assigned on 2002-10-10 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0539
Assigned on 2008-02-14 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0191
Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forBUD20/YLR074C for BUD20
1) Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BUD20/YLR074C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BUD20/YLR074C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MGRYSVK

C-term STASAST

Length(aa) 166

MW(Da) 18,517

pI 9.57

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.131

Codon Adaptation Index 0.133

Frequency of Optimal Codons 0.472

Hydropathicity of Protein -0.689

Aromaticity Score 0.054

10 20 30 40 50 | | | | | MGRYSVKRYKTKRRTRDLDLIYNDLSTKESVQKLLNQPLDETKPGLGQHY CIHCAKYMETAIALKTHLKGKVHKRRVKELRGVPYTQEVSDAAAGYNLNK FLNRVQEITQSVGPEKESNEALLKEHLDSTLANVKTTEPTLPWAAADAEA NTAAVTEAESTASAST*

Protein Structures from PDB: proteins of known structure with sequence similarity to BUD20/YLR074C, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to BUD20 Homolog Source (per PDB) Protein Alignment: BUD20 vs. Homolog External Links
P-Value %Identical %Similar Alignment
1zr9 ( Chain: A)
Solution structure of a human c2h2-type zinc finger protein
PDB_Info
PDB_Structure
Homo sapiens 8.7e-11 38 22 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
BUD20 2001-08-13 Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Standard Name	Date Standardized	Reference
BUD20	2001-08-13	Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YLR074C SGD Systematic Sequence

850763 NCBI: Gene ID

NP_013175.1 NCBI: RefSeq protein version ID

NP_013175.1 NCBI: RefSeq protein version ID

6323103 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YLR074C	SGD Systematic Sequence
850763	NCBI: Gene ID
NP_013175.1	NCBI: RefSeq protein version ID
NP_013175.1	NCBI: RefSeq protein version ID
6323103	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
14 curated references; 0 references not yet curated
Genetic Interactions
Regulatory Role
Willis IM, et al. (2008) Genetic interactions of MAF1 identify a role for Med20 in transcriptional repression of ribosomal protein genes. PLoS Genet 4(7):e1000112
           |ACS2 |BRP1 |DED81 |ERG12 |FYV5 |GCD10 |GRC3 |GYP1 |HCR1 |ILM1 |IRC13 |KEM1 |KRS1 |LOS1 |MORE
DNA/RNA Sequence Features
Steigele S, et al. (2007) Comparative analysis of structured RNAs in S. cerevisiae indicates a multitude of different functions. BMC Biol 5:25
       |AIM5 |ALR1 |AMA1 |ARC40 |ARG1 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |ASR1 |ATP2 |BMH1 |BMH2 |BRP1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Bassler J, et al. (2006) The NUG1 GTPase reveals and N-terminal RNA-binding domain that is essential for association with 60 S pre-ribosomal particles. J Biol Chem 281(34):24737-44
       |DBP10 |NOC2 |NOC3 |NOG2 |NUG1
Regulation of
Transcription
Buck MJ and Lieb JD (2006) A chromatin-mediated mechanism for specification of conditional transcription factor targets. Nat Genet 38(12):1446-51
         |ACA1 |ACS1 |ADE3 |ADH1 |AGP1 |AIM38 |ANP1 |AQY1 |ASC1 |AST2 |ATG19 |AZF1 |BDF1 |BSC3 |MORE
Protein Processing/Modification/Regulation
Panse VG, et al. (2006) Formation and nuclear export of preribosomes are functionally linked to the small-ubiquitin-related modifier pathway. Traffic 7(10):1311-21
             |ARX1 |CIC1 |ECM1 |ENP1 |LSG1 |MEX67 |MTR2 |NOP14 |NOP7 |NSA1 |NUG1 |PWP2 |RIX1 |RIX7 |MORE
Non-Fungal Related Genes/Proteins
Voutev R, et al. (2006) Alterations in ribosome biogenesis cause specific defects in C. elegans hermaphrodite gonadogenesis. Dev Biol 298(1):45-58
       |ERB1 |IPI1 |IPI3 |MRD1 |NOC2 |NOP15 |NUG1 |RSA4 |SDA1 |TIF6
DNA/RNA Sequence Features
Function/Process
Regulation of
Wade CH, et al. (2006) The budding yeast rRNA and ribosome biosynthesis (RRB) regulon contains over 200 genes. Yeast 23(4):293-306
       |AAH1 |ALB1 |ARX1 |ATC1 |BCP1 |BRX1 |BUD22 |CBF5 |CGR1 |CIC1 |CMS1 |DBP10 |DBP6 |DBP7 |MORE
Reviews
Granneman S and Baserga SJ (2004) Ribosome biogenesis: of knobs and RNA processing. Exp Cell Res 296(1):43-50
         |ARX1 |BFR2 |BMS1 |BRX1 |BUD21 |CBF5 |CGR1 |CIC1 |CMS1 |DBP10 |DBP2 |DBP3 |DBP6 |DBP7 |MORE
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Reviews
Fromont-Racine M, et al. (2003) Ribosome assembly in eukaryotes. Gene 313:17-42
         |ARX1 |BFR2 |BMS1 |BRX1 |BUD21 |CBF5 |CGR1 |CIC1 |CMS1 |DBP10 |DBP2 |DBP3 |DBP6 |DBP7 |MORE
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       |ALG8 |BUD13 |BUD14 |BUD16 |BUD17 |BUD19 |BUD21 |BUD22 |BUD23 |BUD25 |BUD26 |BUD27 |BUD28 |BUD30 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42
             |AAD4 |AIM22 |ALG12 |ALK2 |ARE2 |ARG2 |ARP5 |ASI2 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |MORE
Cellular Location
Protein Physical Properties
Strains/Constructs
Techniques and Reagents
Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51
       |AIM4 |ASM4 |BMS1 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MLP1 |MORE
Protein Sequence Features
Bohm S, et al. (1997) Variations of the C2H2 zinc finger motif in the yeast genome and classification of yeast zinc finger proteins. Nucleic Acids Res 25(12):2464-9
       |ACE2 |ADR1 |AZF1 |BRE4 |CMR3 |COM2 |CRZ1 |FZF1 |GIS1 |IRC2 |JJJ1 |MET31 |MET32 |MIG1 |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.