---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SPC3/YLR066W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXII: 267170 to 267724 CDS: 267170 - 267724 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SPC3	YLR066W		ORF, Verified	S000004056
Description
Subunit of signal peptidase complex (Spc1p, Spc2p, Spc3p, Sec11p), which catalyzes cleavage of N-terminal signal sequences of proteins targeted to the secretory pathway; homologous to mammalian SPC22/23

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By peptidase activity Fang H, et al. (1997) In addition to SEC11, a newly identified gene, SPC3, is essential for signal peptidase activity in the yeast endoplasmic reticulum. J Biol Chem 272(20):13152-8        IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD Meyer HA and Hartmann E (1997) The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. J Biol Chem 272(20):13159-64        IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007653 Assigned on 2008-10-13 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By peptide metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein maturation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein processing Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein targeting to ER Meyer HA and Hartmann E (1997) The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. J Biol Chem 272(20):13159-64        IMP : Inferred from Mutant Phenotype Assigned on 2006-08-07 SGD signal peptide processing Fang H, et al. (1997) In addition to SEC11, a newly identified gene, SPC3, is essential for signal peptidase activity in the yeast endoplasmic reticulum. J Biol Chem 272(20):13152-8        IMP : Inferred from Mutant Phenotype ISS : Inferred from Sequence or structural Similarity IGI : Inferred from Genetic Interaction Assigned on 2001-01-18 SGD Meyer HA and Hartmann E (1997) The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. J Biol Chem 272(20):13159-64        ISS : Inferred from Sequence or structural Similarity IMP : Inferred from Mutant Phenotype IPI : Inferred from Physical Interaction IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007653 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007653 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9906 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB signal peptidase complex YaDeau JT, et al. (1991) Yeast signal peptidase contains a glycoprotein and the Sec11 gene product. Proc Natl Acad Sci U S A 88(2):517-21        IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007653 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for SPC3/YLR066W for SPC3 SPC3 encodes a subunit of the signal peptidase complex (SPC), which cleaves the signal sequence from proteins targeted to the endoplasmic reticulum (ER) (1, 2). Signal peptide cleavage occurs concomitantly with translocation through the translocon pore into the ER. In yeast, translocation can occur cotranslationally or posttranslationally, whereas in mammals translocation is always cotranslational. The process of protein translocation into the ER is reviewed in references 3 and 4. The yeast SPC comprises four proteins, Spc1p, Spc2p, Spc3p, and Sec11p (5, 6). Spc3p is homologous to the mammalian signal peptidase subunit SPC22/23 (1, 2). SPC3 is essential for viability and for signal peptidase activity (1, 2). Depletion of Spc3p causes loss of signal peptidase activity and reduces levels of the other SPC proteins (2). Overexpression of SPC3 suppresses a temperature-sensitive mutation in SEC11, which encodes the catalytic SPC subunit (1), and Spc3p and Sec11p can be coimmunoprecipitated (7). Last Updated: 2000-12-08

Basic References [TOP]

BASIC INFORMATION REFERENCES forSPC3/YLR066W for SPC3 1) Fang H, et al. (1997) In addition to SEC11, a newly identified gene, SPC3, is essential for signal peptidase activity in the yeast endoplasmic reticulum. J Biol Chem 272(20):13152-8        2) Meyer HA and Hartmann E (1997) The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. J Biol Chem 272(20):13159-64        3) Rapoport TA, et al. (1996) Protein transport across the eukaryotic endoplasmic reticulum and bacterial inner membranes. Annu Rev Biochem 65:271-303      4) Johnson AE and van Waes MA (1999) The translocon: a dynamic gateway at the ER membrane. Annu Rev Cell Dev Biol 15:799-842        5) YaDeau JT, et al. (1991) Yeast signal peptidase contains a glycoprotein and the Sec11 gene product. Proc Natl Acad Sci U S A 88(2):517-21        6) Antonin W, et al. (2000) Interactions between Spc2p and other components of the endoplasmic reticulum translocation sites of the yeast Saccharomyces cerevisiae. J Biol Chem 275(44):34068-72        7) VanValkenburgh C, et al. (1999) The catalytic mechanism of endoplasmic reticulum signal peptidase appears to be distinct from most eubacterial signal peptidases. J Biol Chem 274(17):11519-25

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SPC3/YLR066W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SPC3/YLR066W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MFSFVQR C-term VENKNKV Length(aa) 184 MW(Da) 21,349 pI 9.52 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.008   Codon Adaptation Index 0.147   Frequency of Optimal Codons 0.437   Hydropathicity of Protein -0.267   Aromaticity Score 0.141	10 20 30 40 50 | | | | | MFSFVQRFQNVSNQAFSMGIVMVVFIMASSYYQLINNNAFSVPSNIDNVK TLINVRTSRYFGSQRGKAKENMKIKFDLNTDLTPLFNWNTKQVFVYLTAE YNSTEKITSEVTFWDKIIKSKDDAVIDVNDLRSKYSIWDIEDGKFEGKDL VFKLHWNVQPWVGLLTYGETVGNYTLTVENKNKV*

Protein Structures from PDB: proteins of known structure with sequence similarity to SPC3/YLR066W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SPC3	SGD (2007) Information without a citation in SGD

Mapping Notes

Date	Note
1996-09-21	Edition 13: Spc3p is a component of signal peptidase complex with Spc1p, Spc2p, and Sec11p. Cherry JM, et al. (1996) "Genetic and Physical Maps of Saccharomyces cerevisiae (Edition 13)". Pp. 361-364 in 1996 Yeast Genetics and Molecular Biology Meeting Program and Abstracts. Bethesda, MD: The Genetics Society of America

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YLR066W	SGD Systematic Sequence
850755	NCBI: Gene ID
NP_013167.1	NCBI: RefSeq protein version ID
NP_013167.1	NCBI: RefSeq protein version ID
6323095	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
7 curated references; 0 references not yet curated
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Cross-species Expression Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	De La Rosa JM, et al. (2004) Characterization of Candida albicans orthologue of the Saccharomyces cerevisiae signal-peptidase-subunit encoding gene SPC3. Yeast 21(10):883-94	|SEC11 |SEC61
Cellular Location Function/Process Protein-protein Interactions Regulation of	Antonin W, et al. (2000) Interactions between Spc2p and other components of the endoplasmic reticulum translocation sites of the yeast Saccharomyces cerevisiae. J Biol Chem 275(44):34068-72	|SBH1 |SBH2 |SEC11 |SEC61 |SPC1 |SPC2 |SSH1 |SSS1
Cellular Location Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein-protein Interactions Strains/Constructs Techniques and Reagents	VanValkenburgh C, et al. (1999) The catalytic mechanism of endoplasmic reticulum signal peptidase appears to be distinct from most eubacterial signal peptidases. J Biol Chem 274(17):11519-25	|SEC11
Cellular Location DNA/RNA Sequence Features Function/Process Non-Fungal Related Genes/Proteins	Fang H, et al. (1997) In addition to SEC11, a newly identified gene, SPC3, is essential for signal peptidase activity in the yeast endoplasmic reticulum. J Biol Chem 272(20):13152-8	|SEC11 |SPC2
Cellular Location Function/Process Mutants/Phenotypes	Meyer HA and Hartmann E (1997) The yeast SPC22/23 homolog Spc3p is essential for signal peptidase activity. J Biol Chem 272(20):13159-64	|SEC11 |SPC2
Cellular Location Other Features	YaDeau JT and Blobel G (1989) Solubilization and characterization of yeast signal peptidase. J Biol Chem 264(5):2928-34	|SEC11 |SPC1 |SPC2

Return to SGD

Send a Message to the SGD Curators