---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ERG3/YLR056W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrXII: 253862 to 254959 CDS: 253862 - 254959 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ERG3	YLR056W	SYR1, PSO6	ORF, Verified	S000004046
Description
C-5 sterol desaturase, catalyzes the introduction of a C-5(6) double bond into episterol, a precursor in ergosterol biosynthesis; mutants are viable, but cannot grow on non-fermentable carbon sources

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By C-5 sterol desaturase activity Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD iron ion binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006694 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0408 Assigned on 2007-05-23 UniProtKB oxidoreductase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006694 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By alcohol metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular lipid metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular metabolic compound salvage Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT endocytosis Kishimoto T, et al. (2005) Defects in structural integrity of ergosterol and the Cdc50p-Drs2p putative phospholipid translocase cause accumulation of endocytic membranes, onto which actin patches are assembled in yeast. Mol Biol Cell 16(12):5592-609        IGI : Inferred from Genetic Interaction with SGD:CDC50, SGD:DRS2 Assigned on 2005-12-08 SGD ergosterol biosynthetic process Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD fatty acid biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006694 Assigned on 2009-01-12 UniProtKB lipid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0444 Assigned on 2007-05-23 UniProtKB oxidation reduction DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006694 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2008-05-21 UniProtKB steroid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0752 Assigned on 2007-05-23 UniProtKB sterol biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0756 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR006694 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
ergosterol biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ERG3/YLR056W for ERG3 ERG3 encodes C-5 sterol desaturase, which catalyzes the introduction of a C-5(6) double bond into episterol, a precursor in ergosterol biosynthesis (1, 2, 3, 4). Cells lacking ERG3 are viable, but cannot grow on non-fermentable carbon sources, and some erg3 null strains are cold sensitive (1, 5, 6). Mutations in ERG3 alter sensitivity to a wide variety of drugs (7, 8, 9, 10). A mutation in ERG3 can suppress the erg11 null phenotype (11), and the erg3 erg11 double mutant is resistant to fenpropimorph (12). Mutations in genes encoding other sterol biosynthetic enzymes cause increased expression of ERG3 (13, 14). Expression of ERG9, which encodes farnesyl-diphosphate farnesyl transferase, is increased in erg3 mutants (15). C-5 sterol desaturases have been identified in numerous organisms; homologs from Candida albicans, Arabidopsis, Nicotiana tabacum, and human can complements the erg3 null phenotype (16, 17, 18). Last Updated: 2000-09-06

Basic References [TOP]

BASIC INFORMATION REFERENCES forERG3/YLR056W for ERG3 1) Arthington BA, et al. (1991) Cloning, disruption and sequence of the gene encoding yeast C-5 sterol desaturase. Gene 102(1):39-44      2) Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    3) Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6      4) Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30      5) Smith SJ and Parks LW (1993) The ERG3 gene in Saccharomyces cerevisiae is required for the utilization of respiratory substrates and in heme-deficient cells. Yeast 9(11):1177-87      6) Hemmi K, et al. (1995) The physiological roles of membrane ergosterol as revealed by the phenotypes of syr1/erg3 null mutant of Saccharomyces cerevisiae. Biosci Biotechnol Biochem 59(3):482-6      7) Watson PF, et al. (1988) Isolation and analysis of ketoconazole resistant mutants of Saccharomyces cerevisiae. J Med Vet Mycol 26(3):153-62      8) Taguchi N, et al. (1994) Identification and analysis of the Saccharomyces cerevisiae SYR1 gene reveals that ergosterol is involved in the action of syringomycin. Microbiology 140 ( Pt 2):353-9      9) Prendergast JA, et al. (1995) Mutations sensitizing yeast cells to the start inhibitor nalidixic acid. Yeast 11(6):537-47      10) Schmidt CL, et al. (1999) Allelism of Saccharomyces cerevisiae genes PSO6, involved in survival after 3-CPs+UVA induced damage, and ERG3, encoding the enzyme sterol C-5 desaturase. Yeast 15(14):1503-10        11) Bard M, et al. (1993) Sterol synthesis and viability of erg11 (cytochrome P450 lanosterol demethylase) mutations in Saccharomyces cerevisiae and Candida albicans. Lipids 28(11):963-7      12) Lorenz RT and Parks LW (1991) Physiological effects of fenpropimorph on wild-type Saccharomyces cerevisiae and fenpropimorph-resistant mutants. Antimicrob Agents Chemother 35(8):1532-7      13) Arthington-Skaggs BA, et al. (1996) Positive and negative regulation of a sterol biosynthetic gene (ERG3) in the post-squalene portion of the yeast ergosterol pathway. FEBS Lett 392(2):161-5        14) Smith SJ, et al. (1996) Transcriptional regulation by ergosterol in the yeast Saccharomyces cerevisiae. Mol Cell Biol 16(10):5427-32        15) Kennedy MA, et al. (1999) Transcriptional regulation of the squalene synthase gene (ERG9) in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1445(1):110-22      16) Gachotte D, et al. (1996) Isolation and characterization of an Arabidopsis thaliana cDNA encoding a delta 7-sterol-C-5-desaturase by functional complementation of a defective yeast mutant. Plant J 9(3):391-8      17) Husselstein T, et al. (1999) Delta7-sterol-C5-desaturase: molecular characterization and functional expression of wild-type and mutant alleles. Plant Mol Biol 39(5):891-906      18) Miyazaki Y, et al. (1999) Cloning, sequencing, expression and allelic sequence diversity of ERG3 (C-5 sterol desaturase gene) in Candida albicans. Gene 236(1):43-51

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERG3/YLR056W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERG3/YLR056W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MDLVLEV C-term PNTKKNN Length(aa) 365 MW(Da) 42,730 pI 7.73 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.304   Codon Adaptation Index 0.249   Frequency of Optimal Codons 0.587   Hydropathicity of Protein -0.048   Aromaticity Score 0.153	10 20 30 40 50 | | | | | MDLVLEVADHYVLDDLYAKVLPASLAANIPVKWQKLLGLNSGFSNSTILQ ETLNSKNAVKECRRFYGQVPFLFDMSTTSFASLLPRSSILREFLSLWVIV TIFGLLLYLFTASLSYVFVFDKSIFNHPRYLKNQMAMEIKLAVSAIPWMS MLTVPWFVMELNGHSKLYMKIDYENHGVRKLIIEYFTFIFFTDCGVYLAH RWLHWPRVYRALHKPHHKWLVCTPFASHSFHPVDGFLQSISYHIYPLILP LHKVSYLILFTFVNFWTVMIHDGQYLSNNPAVNGTACHTVHHLYFNYNYG QFTTLWDRLGGSYRRPDDSLFDPKLRDAKETWDAQVKEVEHFIKEVEGDD NDRIYENDPNTKKNN*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERG3/YLR056W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ERG3	SGD (2007) Information without a citation in SGD

Alias Name(s)	Reference
PSO6	Brendel M and Henriques JA (2001) The pso mutants of Saccharomyces cerevisiae comprise two groups: one deficient in DNA repair and another with altered mutagen metabolism. Mutat Res 489(1):79-96

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YLR056W	SGD Systematic Sequence
850745	NCBI: Gene ID
NP_013157.1	NCBI: RefSeq protein version ID
NP_013157.1	NCBI: RefSeq protein version ID
6323085	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
138 curated references; 0 references not yet curated
Cross-species Expression Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Brumfield KM, et al. (2010) Functional characterization of the Chlamydomonas reinhardtii ERG3 ortholog, a gene involved in the biosynthesis of ergosterol. PLoS One 5(1):e8659
Genetic Interactions Mutants/Phenotypes	Hodg CA, et al. (2010) Integral membrane proteins Brr6 and Apq12 link assembly of the nuclear pore complex to lipid homeostasis in the endoplasmic reticulum. J Cell Sci 123(Pt 1):141-151	|ACC1 |APQ12 |ARE1 |ARE2 |ARV1 |BRR6 |DGA1 |ELO1 |ERG2 |ERG4 |ERG5 |ERG6 |FEN1 |LRO1 |MORE
Fungal Related Genes/Proteins Genetic Interactions Infection and Antifungals Mutants/Phenotypes Strains/Constructs	Robbins N, et al. (2010) Metabolic control of antifungal drug resistance. Fungal Genet Biol 47(2):81-93	|FPR1 |FRT1 |FRT2 |GCN4 |HIS3 |HOM3 |TOR1 |TOR2
Mutants/Phenotypes Strains/Constructs	Abe F and Hiraki T (2009) Mechanistic role of ergosterol in membrane rigidity and cycloheximide resistance in Saccharomyces cerevisiae. Biochim Biophys Acta 1788(3):743-52	|ERG2 |ERG4 |ERG5 |ERG6 |PDR5 |UPC2
Mutants/Phenotypes Strains/Constructs	Abe F, et al. (2009) Fluconazole modulates membrane rigidity, heterogeneity, and water penetration into the plasma membrane in Saccharomyces cerevisiae. Biochemistry 48(36):8494-504
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Burston HE, et al. (2009) Regulators of yeast endocytosis identified by systematic quantitative analysis. J Cell Biol 185(6):1097-110	|ABP1 |ADE12 |AIM21 |AIP1 |APL1 |ARC18 |ATG20 |BBC1 |BZZ1 |CAP1 |CAP2 |CHC1 |CHO2 |CLC1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Daicho K, et al. (2009) Sorting defects of the tryptophan permease Tat2 in an erg2 yeast mutant. FEMS Microbiol Lett 298(2):218-27	|ERG2 |ERG4 |ERG5 |ERG6 |TAT2 |TRP1
Other Features	Emmert-Streib F and Dehmer M (2009) Predicting cell cycle regulated genes by causal interactions. PLoS One 4(8):e6633	|ACE2 |ADR1 |ECM22 |EEB1 |FKH2 |FLC3 |HCM1 |KEX2 |MNN1 |PCL7 |PHO4 |PIP2 |RAP1 |REB1 |MORE
Mutants/Phenotypes Strains/Constructs	Francois IE, et al. (2009) Membrane rafts are involved in intracellular miconazole accumulation in yeast cells. J Biol Chem 284(47):32680-5	|ADH1 |DOS2 |IPT1 |LCL1 |MRPL23 |PTH1 |SIP3 |SKN1 |SUR1 |YDR114C |YOR292C
Mutants/Phenotypes Strains/Constructs	Ho CH, et al. (2009) A molecular barcoded yeast ORF library enables mode-of-action analysis of bioactive compounds. Nat Biotechnol 27(4):369-77	|EFT2 |ERG2 |FPR1 |MVD1 |RPL28
Mutants/Phenotypes Strains/Constructs	Jones L, et al. (2009) Cdc42p is activated during vacuole membrane fusion in a sterol-dependent subreaction of priming. J Biol Chem	|CDC42 |ERG2 |ERG4 |ERG5 |ERG6 |RDI1 |SEC17 |SEC18 |STE20
RNA Levels and Processing	Pedroso N, et al. (2009) Modulation of plasma membrane lipid profile and microdomains by H(2)O(2) in Saccharomyces cerevisiae. Free Radic Biol Med 46(2):289-98	|ACC1 |ELO1 |ERG1 |ERG25 |ERG6 |ERG7 |FAS1 |FEN1 |GPT2 |LAC1 |LIP1 |OLE1 |RAD27 |SUR4
Regulation of Transcription	Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461	|AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
Mutants/Phenotypes Strains/Constructs	Westmoreland TJ, et al. (2009) Comparative genome-wide screening identifies a conserved doxorubicin repair network that is diploid specific in Saccharomyces cerevisiae. PLoS ONE 4(6):e5830	|AFG3 |AKR1 |ARP5 |BEM1 |CCR4 |CTF4 |CTK1 |DBF2 |DHH1 |HFI1 |HOM6 |HPR1 |LGE1 |LSM7 |MORE
Industrial Applications Non-Fungal Related Genes/Proteins	Yoon SH, et al. (2009) Combinatorial expression of bacterial whole mevalonate pathway for the production of beta-carotene in E. coli. J Biotechnol 140(3-4):218-26	|ERG12 |IDI1 |MVD1
Mutants/Phenotypes	Yoshikawa K, et al. (2009) Comprehensive phenotypic analysis for identification of genes affecting growth under ethanol stress in Saccharomyces cerevisiae. FEMS Yeast Res 9(1):32-44	|ALD6 |ARO1 |ARO2 |ARO7 |COQ10 |COQ5 |COQ9 |COX11 |COX12 |COX14 |COX16 |COX18 |COX23 |COX7 |MORE
Mutants/Phenotypes Strains/Constructs	de Graaf B, et al. (2009) Cellular pathways for DNA repair and damage tolerance of formaldehyde-induced DNA-protein crosslinks. DNA Repair (Amst) 8(10):1207-14	|ADH1 |ARP5 |BEM4 |CDC26 |CDC50 |CTF4 |DAL81 |ECM30 |ERG5 |ERG6 |LSM1 |MED1 |MGM101 |MMS22 |MORE
RNA Levels and Processing Regulation of	Bonander N, et al. (2008) Transcriptome analysis of a respiratory Saccharomycescerevisiae strain suggests the expression of its phenotype is glucose insensitive and predominantly controlled by Hap4, Cat8 and Mig1. BMC Genomics 9:365	|ALD6 |ARI1 |ATO2 |BDH1 |BDH2 |CAT2 |CAT8 |CDC19 |CRC1 |CYB2 |DLD3 |DSF1 |FBP1 |GLK1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Chanklan R, et al. (2008) Identification of Saccharomyces cerevisiae Tub1 alpha-tubulin as a potential target for NKH-7, a cytotoxic 1-naphthol derivative compound. Biosci Biotechnol Biochem 72(4):1023-31	|PDR1 |PDR3 |PDR5 |TUB1 |TUB3 |YOR1 |YRR1 |ZDS1
Function/Process Mutants/Phenotypes Strains/Constructs	Fei W, et al. (2008) Genome-wide analysis of sterol-lipid storage and trafficking in Saccharomyces cerevisiae. Eukaryot Cell 7(2):401-14	|ARV1 |CAX4 |CDC50 |CNB1 |DRS2 |PLC1 |PTC1 |UME6 |VMA21 |VMA9
Mutants/Phenotypes	Folmer V, et al. (2008) H(2)O(2) induces rapid biophysical and permeability changes in the plasma membrane of Saccharomyces cerevisiae. Biochim Biophys Acta 1778(4):1141-7	|ERG6
RNA Levels and Processing Regulation of	Guo N, et al. (2008) Global gene expression profile of Saccharomyces cerevisiae induced by dictamnine. Yeast 25(9):631-41	|ADE1 |ADE12 |ADE13 |ADE16 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADE8 |ADY2 |APT1 |CBF1 |CIS3 |MORE
Regulation of Strains/Constructs Transcription	Hausmann A, et al. (2008) Cellular and Mitochondrial Remodeling upon Defects in Iron-Sulfur Protein Biogenesis. J Biol Chem 283(13):8318-30	|ACO1 |AFT1 |AGP3 |ALD4 |ARN1 |ATM1 |BIO2 |BIO5 |CIT2 |COX4 |CTT1 |CYB5 |CYC1 |CYT2 |MORE
Fungal Related Genes/Proteins	Iwaki T, et al. (2008) Multiple functions of ergosterol in the fission yeast Schizosaccharomyces pombe. Microbiology 154(Pt 3):830-41	|ERG2 |ERG4 |ERG5 |ERG6
Mutants/Phenotypes	Jin H, et al. (2008) Ergosterol promotes pheromone signaling and plasma membrane fusion in mating yeast. J Cell Biol 180(4):813-26	|ERG2 |ERG6 |LCB1 |PRM1 |STE5
Mutants/Phenotypes Strains/Constructs	Ogasawara Y, et al. (2008) New eremophilane sesquiterpenoid compounds, eremoxylarins a and B directly inhibit calcineurin in a manner independent of immunophilin. J Antibiot (Tokyo) 61(8):496-502	|CMP2 |CNA1 |CNB1 |PDR1 |PDR3 |ZDS1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Paluszynski JP, et al. (2008) Genetic prerequisites for additive or synergistic actions of 5-fluorocytosine and fluconazole in baker's yeast. Microbiology 154(Pt 10):3154-64	|ERG11 |FCY1 |FCY2 |FUR1 |URA10 |URA5
Mutants/Phenotypes	Ulanovskaya OA, et al. (2008) Synthesis enables identification of the cellular target of leucascandrolide A and neopeltolide. Nat Chem Biol 4(7):418-24	|ATG11 |COB |COR1 |CYT1 |ERG6 |HOM3 |KCS1 |PPA1 |QCR10 |QCR2 |QCR6 |QCR7 |QCR8 |QCR9 |MORE
Genetic Interactions Infection and Antifungals Mutants/Phenotypes Strains/Constructs	Welscher YM, et al. (2008) Natamycin Blocks Fungal Growth by Binding Specifically to Ergosterol without Permeabilizing the Membrane. J Biol Chem 283(10):6393-401	|ERG2 |ERG4 |ERG5 |ERG6
Reviews	Lehoczky P, et al. (2007) DNA interstrand cross-link repair in Saccharomyces cerevisiae. FEMS Microbiol Rev 31(2):109-33	|COX11 |MAG1 |MEC3 |MRE11 |PRP19 |PSO2 |RAD1 |RAD10 |RAD14 |RAD16 |RAD18 |RAD2 |RAD23 |RAD30 |MORE
Fungal Related Genes/Proteins Regulation of Transcription	Rautio JJ, et al. (2007) Monitoring yeast physiology during very high gravity wort fermentations by frequent analysis of gene expression. Yeast 24(9):741-60	|AAD6 |ADH1 |ADH2 |ADH3 |ADH4 |ALD6 |ARG1 |ASH1 |ATF1 |ATF2 |BAT1 |BAT2 |CCP1 |CLN2 |MORE
Reviews	Schulz TA and Prinz WA (2007) Sterol transport in yeast and the oxysterol binding protein homologue (OSH) family. Biochim Biophys Acta 1771(6):769-80	|AUS1 |CAT5 |DAN1 |ERG1 |ERG11 |ERG27 |ERG5 |ERG6 |ERG7 |HES1 |KES1 |MGM101 |NCR1 |NPC2 |MORE
Genetic Interactions Strains/Constructs	Shah Alam Bhuiyan M, et al. (2007) Synthetically lethal interactions involving loss of the yeast ERG24: the sterol C-14 reductase gene. Lipids 42(1):69-76	|ERG2 |ERG24 |ERG28 |ERG6 |SUR4
Regulation of	Soontorngun N, et al. (2007) Regulation of Gluconeogenesis in Saccharomyces cerevisiae Is Mediated by Activator and Repressor Functions of Rds2. Mol Cell Biol 27(22):7895-905	|ACS2 |AQR1 |CAT8 |CIT1 |COX6 |CYC1 |FBP1 |GID8 |HAP4 |HXT9 |ICY1 |IDP2 |KGD2 |LSC2 |MORE
Mutants/Phenotypes	Xia L, et al. (2007) Identification of genes required for protection from doxorubicin by a genome-wide screen in Saccharomyces cerevisiae. Cancer Res 67(23):11411-8	|ADK1 |AFG3 |ARP8 |ASC1 |ASF1 |BEM1 |BEM4 |BUD22 |CCS1 |COX6 |DBP3 |FLX1 |GAS1 |GND1 |MORE
Large-scale phenotype analysis	Yadav J, et al. (2007) A phenomics approach in yeast links proton and calcium pump function in the Golgi. Mol Biol Cell 18(4):1480-9	|CUP5 |ERG2 |ERG4 |ERG6 |GAL11 |GCN4 |GCN5 |HFI1 |NHP10 |OPI1 |PMR1 |RPN4 |SAC1 |SET3 |MORE
Genetic Interactions Genomic expression study Mutants/Phenotypes	Anderson JB, et al. (2006) Antagonism between Two Mechanisms of Antifungal Drug Resistance. Eukaryot Cell 5(8):1243-51	|PDR1 |PDR3
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Cowen LE, et al. (2006) Genetic architecture of Hsp90-dependent drug resistance. Eukaryot Cell 5(12):2184-8	|CNB1 |CRZ1 |FRT1 |FRT2 |HSC82 |HSP82
Regulation of Transcription	Davies BS and Rine J (2006) A role for sterol levels in oxygen sensing in Saccharomyces cerevisiae. Genetics 174(1):191-201	|ANB1 |COX5B |DAN1 |ECM22 |ERG10 |ERG2 |HAP1 |IDI1 |MOT3 |TIR1 |UPC2
Mutants/Phenotypes Strains/Constructs	Sharma SC (2006) Implications of sterol structure for membrane lipid composition, fluidity and phospholipid asymmetry in Saccharomyces cerevisiae. FEMS Yeast Res 6(7):1047-51	|ERG2 |ERG6
Mutants/Phenotypes Strains/Constructs	Simons V, et al. (2006) Dual effects of plant steroidal alkaloids on Saccharomyces cerevisiae. Antimicrob Agents Chemother 50(8):2732-40	|ERG2 |ERG6
RNA Levels and Processing Regulation of	Tanaka F, et al. (2006) Functional genomic analysis of commercial baker's yeast during initial stages of model dough-fermentation. Food Microbiol 23(8):717-28	|ACE2 |ACO1 |ACS1 |ACS2 |ACT1 |ADH1 |ADH2 |ADH5 |ADK1 |AIM38 |ALD2 |ALG8 |ARG1 |ARG3 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Viau C, et al. (2006) Sensitivity to Sn(2+) of the Yeast Saccharomyces cerevisiae Depends on General Energy Metabolism, Metal Transport, Anti-Oxidative Defences, and DNA Repair. Biometals 19(6):705-14	|APN1 |ATR1 |COX11 |COX14 |COX15 |COX16 |COX17 |COX18 |COX20 |CTT1 |NTG1 |NTG2 |PET100 |PET117 |MORE
Cellular Location Strains/Constructs	Voeltz GK, et al. (2006) A class of membrane proteins shaping the tubular endoplasmic reticulum. Cell 124(3):573-86	|ERP2 |OST1 |RTN1 |RTN2 |SEC63 |SUR2 |WBP1 |YOP1
Fungal Related Genes/Proteins	Akins RA (2005) An update on antifungal targets and mechanisms of resistance in Candida albicans. Med Mycol 43(4):285-318	|ERG11
Fungal Related Genes/Proteins Genetic Interactions Infection and Antifungals Mutants/Phenotypes Strains/Constructs	Cowen LE and Lindquist S (2005) Hsp90 potentiates the rapid evolution of new traits: drug resistance in diverse fungi. Science 309(5744):2185-9	|CKA2 |CNA1 |CNB1 |CPR1 |ERG6 |HSC82 |LCL1 |PDR1 |PDR5 |RTC2 |SCS2 |YGR283C |YLR407W |YMR099C |MORE
Genetic Interactions Mutants/Phenotypes Protein-Nucleic Acid Interactions Strains/Constructs Transcription	Davies BS, et al. (2005) Dual activators of the sterol biosynthetic pathway of Saccharomyces cerevisiae: similar activation/regulatory domains but different response mechanisms. Mol Cell Biol 25(16):7375-85	|ECM22 |ERG2 |ERG4 |UPC2
Fungal Related Genes/Proteins	Ferreira ME, et al. (2005) The ergosterol biosynthesis pathway, transporter genes, and azole resistance in Aspergillus fumigatus. Med Mycol 43 Suppl 1:S313-9	|ERG11
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22	|ACB1 |ACC1 |ARE1 |ARE2 |AYR1 |CSG2 |DPL1 |ELO1 |ERG24 |ERG4 |ERG5 |FEN1 |HEM1 |IFA38 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kishimoto T, et al. (2005) Defects in structural integrity of ergosterol and the Cdc50p-Drs2p putative phospholipid translocase cause accumulation of endocytic membranes, onto which actin patches are assembled in yeast. Mol Biol Cell 16(12):5592-609	|ABP1 |ACT1 |BNI1 |CDC42 |CDC50 |DRS2 |ERG2 |ERG4 |ERG5 |ERG6 |GIC1 |LAS17 |SLA2 |SNC1
RNA Levels and Processing Regulation of	Kleinschmidt M, et al. (2005) Transcriptional profiling of Saccharomyces cerevisiae cells under adhesion-inducing conditions. Mol Genet Genomics 273(5):382-93	|AAD10 |APM3 |ARG1 |ARO10 |BAT2 |BIO3 |BRR2 |CPR6 |CUP1-1 |CUP1-2 |CWP2 |DDR48 |ECM22 |ERG12 |MORE
RNA Levels and Processing Regulation of	Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91	|AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE
Protein-protein Interactions Techniques and Reagents	Mo C and Bard M (2005) A systematic study of yeast sterol biosynthetic protein-protein interactions using the split-ubiquitin system. Biochim Biophys Acta 1737(2-3):152-60	|ERG1 |ERG11 |ERG2 |ERG24 |ERG25 |ERG26 |ERG27 |ERG28 |ERG4 |ERG5 |ERG6 |ERG7 |ERG9
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Ott RG, et al. (2005) Flux of sterol intermediates in a yeast strain deleted of the lanosterol C-14 demethylase Erg11p. Biochim Biophys Acta 1735(2):111-8	|ERG11 |ERG6 |ERG7
Mutants/Phenotypes	Sano T, et al. (2005) Regulation of the sphingoid long-chain base kinase Lcb4p by ergosterol and heme: studies in phytosphingosine-resistant mutants. J Biol Chem 280(44):36674-82	|DPL1 |ERG2 |ERG4 |ERG5 |ERG6 |HAP1 |HEM14 |HMG1 |KES1 |LCB3 |LCB4 |PBP1 |PDR5 |TPS1 |MORE
RNA Levels and Processing	Shobayashi M, et al. (2005) Effects of Culture Conditions on Ergosterol Biosynthesis by Saccharomyces cerevisiae. Biosci Biotechnol Biochem 69(12):2381-8	|ERG13 |ERG2 |ERG20 |ERG24 |ERG26 |ERG28 |ERG5 |ERG6 |HMG1
Function/Process Mutants/Phenotypes Strains/Constructs	Zaremberg V, et al. (2005) Cytotoxicity of an anti-cancer lysophospholipid through selective modification of lipid raft composition. J Biol Chem 280(45):38047-58	|FEN1 |LCB1 |PCT1 |PMA1 |SCS7 |SUR4
Mutants/Phenotypes Other Features Strains/Constructs	Anderson JB, et al. (2004) Haploidy, diploidy and evolution of antifungal drug resistance in Saccharomyces cerevisiae. Genetics 168(4):1915-23	|PDR1 |PDR3
Function/Process Mutants/Phenotypes Strains/Constructs	Branco MR, et al. (2004) Decrease of H2O2 plasma membrane permeability during adaptation to H2O2 in Saccharomyces cerevisiae. J Biol Chem 279(8):6501-6	|CCP1 |CTT1 |ERG6
RNA Levels and Processing Regulation of	Jones DL, et al. (2004) Genome-Wide Analysis of the Effects of Heat Shock on a Saccharomyces cerevisiae Mutant With a Constitutively Activated cAMP-Dependent Pathway. Comp Funct Genomics 5(5):419-31	|BTN2 |COX6 |DCS1 |ENO1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG26 |ERG27 |ERG6 |MORE
RNA Levels and Processing Techniques and Reagents	Krantz M, et al. (2004) Anaerobicity prepares Saccharomyces cerevisiae cells for faster adaptation to osmotic shock. Eukaryot Cell 3(6):1381-90	|ALD2 |ALD3 |ALD4 |ALD6 |CTT1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |MORE
Function/Process	Kyoda K, et al. (2004) DBRF-MEGN method: an algorithm for deducing minimum equivalent gene networks from large-scale gene expression profiles of gene deletion mutants. Bioinformatics 20(16):2662-75	|ADE2 |AEP2 |AFG3 |AFT1 |ALD4 |ALD5 |ASE1 |BUD22 |CKA2 |CKB2 |CUP5 |CYC8 |DIG1 |DIG2 |MORE
Mutants/Phenotypes	Lawrence CL, et al. (2004) Evidence of a new role for the high-osmolarity glycerol mitogen-activated protein kinase pathway in yeast: regulating adaptation to citric acid stress. Mol Cell Biol 24(8):3307-23	|ADE4 |AFT1 |AIM18 |AMS1 |ARO2 |BCK1 |BMH1 |BMH2 |BUB1 |CAX4 |CCH1 |CCW14 |CKA1 |CLC1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Markovich S, et al. (2004) Genomic approach to identification of mutations affecting caspofungin susceptibility in Saccharomyces cerevisiae. Antimicrob Agents Chemother 48(10):3871-6	|BCK1 |CCR4 |CHC1 |CHS3 |CHS7 |CKA2 |CSG2 |ERG5 |ERG6 |FKS1 |ILM1 |MID2 |MNN10 |NPL3 |MORE
Other Features	Mo C, et al. (2004) The ERG28-encoded protein, Erg28p, interacts with both the sterol C-4 demethylation enzyme complex as well as the late biosynthetic protein, the C-24 sterol methyltransferase (Erg6p). Biochim Biophys Acta 1686(1-2):30-6	|ERG11 |ERG28 |ERG6 |ERG7
Genomic expression study RNA Levels and Processing Regulation of	Parveen M, et al. (2004) Response of Saccharomyces cerevisiae to a monoterpene: evaluation of antifungal potential by DNA microarray analysis. J Antimicrob Chemother 54(1):46-55	|AAD6 |ADH5 |ADH7 |ADY2 |AGA2 |AMS1 |ARG1 |ARN2 |ATF2 |ATX1 |BCK1 |BFR1 |BSC1 |BUD7 |MORE
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Regulation of Transcription	Agarwal AK, et al. (2003) Genome-wide expression profiling of the response to polyene, pyrimidine, azole, and echinocandin antifungal agents in Saccharomyces cerevisiae. J Biol Chem 278(37):34998-5015	|AGA1 |AMS1 |ATF2 |AUS1 |BAG7 |BAP2 |BAP3 |CRH1 |CTR1 |CWP1 |CYB5 |DAN1 |DAN4 |ELO1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Anderson JB, et al. (2003) Mode of selection and experimental evolution of antifungal drug resistance in Saccharomyces cerevisiae. Genetics 163(4):1287-98	|CKA2 |ERG11 |ERG28 |ERG6 |LCL1 |PDR1 |PDR5 |RTC2 |SCS2 |SML1 |SNQ2 |SWH1 |YGR283C |YLR407W |MORE
Alias Function/Process Mutants/Phenotypes Strains/Constructs	Brendel M, et al. (2003) Role of PSO genes in repair of DNA damage of Saccharomyces cerevisiae. Mutat Res 544(2-3):179-93	|COX11 |MEC3 |MMS21 |PRP19 |PSO2 |RAD6 |REV1 |REV3 |RNR4
Function/Process Mutants/Phenotypes Strains/Constructs	Gupta SS, et al. (2003) Antifungal activity of amiodarone is mediated by disruption of calcium homeostasis. J Biol Chem 278(31):28831-9	|CCH1 |CUP5 |ERG24 |ERG6 |MID1 |PDR5 |PMC1 |PMR1 |PTC1 |RCY1 |SSC1 |VCX1 |VPS45 |YPK1 |MORE
Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Idkowiak-Baldys J, et al. (2003) Structure-function studies of yeast C-4 sphingolipid long chain base hydroxylase. Biochim Biophys Acta 1618(1):17-24	|SUR2
Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Jackson CJ, et al. (2003) Mutations in Saccharomyces cerevisiae sterol C5-desaturase conferring resistance to the CYP51 inhibitor fluconazole. Biochem Biophys Res Commun 309(4):999-1004
Protein Physical Properties Techniques and Reagents	Peng J, et al. (2003) A proteomics approach to understanding protein ubiquitination. Nat Biotechnol 21(8):921-6	|ACS2 |ADE13 |AKL1 |ALD6 |ARO10 |BSD2 |CCT8 |CDC48 |CHD1 |CHS3 |CIT2 |COS4 |CSR2 |CTR9 |MORE
Cross-species Expression Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Pinjon E, et al. (2003) Molecular mechanisms of itraconazole resistance in Candida dubliniensis. Antimicrob Agents Chemother 47(8):2424-37
Fungal Related Genes/Proteins	Young LY, et al. (2003) Disruption of ergosterol biosynthesis confers resistance to amphotericin B in Candida lusitaniae. Antimicrob Agents Chemother 47(9):2717-24	|ERG6
Mutants/Phenotypes Strains/Constructs	Chang M, et al. (2002) A genome-wide screen for methyl methanesulfonate-sensitive mutants reveals genes required for S phase progression in the presence of DNA damage. Proc Natl Acad Sci U S A 99(26):16934-9	|AAT2 |APN1 |ARO1 |ARO7 |ASF1 |BDF1 |BUD25 |BUR2 |CAC2 |CCS1 |CDC40 |CDC50 |CHL1 |CIK1 |MORE
Mutants/Phenotypes Strains/Constructs	Desmoucelles C, et al. (2002) Screening the yeast "disruptome" for mutants affecting resistance to the immunosuppressive drug, mycophenolic acid. J Biol Chem 277(30):27036-44	|ANP1 |BUD30 |CTK1 |CTK3 |DAL81 |DST1 |ERG24 |ERG4 |ERG5 |ERG6 |GCN5 |HOM2 |HPR1 |HTZ1 |MORE
Function/Process Mutants/Phenotypes	Dimmer KS, et al. (2002) Genetic basis of mitochondrial function and morphology in Saccharomyces cerevisiae. Mol Biol Cell 13(3):847-53	|ABF2 |ACO1 |ADA2 |ADK1 |AEP1 |AEP2 |AEP3 |AFG3 |AFT1 |AIM10 |AIM22 |ALY1 |APQ13 |ARG82 |MORE
Mutants/Phenotypes Strains/Constructs	Fleming JA, et al. (2002) Complementary whole-genome technologies reveal the cellular response to proteasome inhibition by PS-341. Proc Natl Acad Sci U S A 99(3):1461-6	|APN1 |ATG17 |BEM4 |BIK1 |CCR4 |CDC26 |CHL1 |CHL4 |CLB2 |CLB5 |CSM3 |CTF19 |CTF8 |DCC1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Pungartnik C, et al. (2002) Further phenotypic characterization of pso mutants of Saccharomyces cerevisiae with respect to DNA repair and response to oxidative stress. Genet Mol Res 1(1):79-89	|COX11 |PRP19 |PSO2 |RAD16 |REV3 |RNR4
Function/Process Mutants/Phenotypes Strains/Constructs	Ruan B, et al. (2002) Alternative pathways of sterol synthesis in yeast. Use of C(27) sterol tracers to study aberrant double-bond migrations and evaluate their relative importance. Steroids 67(13-14):1109-19	|ERG2 |ERG5
Alias Reviews	Brendel M and Henriques JA (2001) The pso mutants of Saccharomyces cerevisiae comprise two groups: one deficient in DNA repair and another with altered mutagen metabolism. Mutat Res 489(1):79-96	|COX11 |MEC3 |PRP19 |PSO2 |RAD16 |RAD6 |REV3 |RNR4
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Hiraga K, et al. (2001) A novel screening for inhibitors of a pleiotropic drug resistant pump, Pdr5, in Saccharomyces cerevisiae. Biosci Biotechnol Biochem 65(7):1589-95	|PDR5 |SNQ2
Function/Process Mutants/Phenotypes Strains/Constructs	Kato M and Wickner W (2001) Ergosterol is required for the Sec18/ATP-dependent priming step of homotypic vacuole fusion. EMBO J 20(15):4035-40	|ERG4 |ERG5 |ERG6 |SEC17 |SEC18
Function/Process Other Features Protein Physical Properties Protein/Nucleic Acid Structure Substrates/Ligands/Cofactors	Rahier A (2001) Deuterated delta 7-cholestenol analogues as mechanistic probes for wild-type and mutated delta 7-sterol-C5(6)-desaturase. Biochemistry 40(1):256-67
Non-Fungal Related Genes/Proteins Protein Sequence Features Substrates/Ligands/Cofactors	Sperling P, et al. (2001) Functional characterization of sphingolipid C4-hydroxylase genes from Arabidopsis thaliana. FEBS Lett 494(1-2):90-4	|SUR2
DNA/RNA Sequence Features Function/Process Protein-Nucleic Acid Interactions Regulation of	Vik A and Rine J (2001) Upc2p and Ecm22p, dual regulators of sterol biosynthesis in Saccharomyces cerevisiae. Mol Cell Biol 21(19):6395-405	|ECM22 |ERG2 |UPC2
Non-Fungal Related Genes/Proteins	Dotson WD, et al. (2000) Biochemical modifications and transcriptional alterations attendant to sterol feeding in Phytophthora parasitica. Lipids 35(3):243-7
Mutants/Phenotypes Substrates/Ligands/Cofactors	Jia MH, et al. (2000) Global expression profiling of yeast treated with an inhibitor of amino acid biosynthesis, sulfometuron methyl. Physiol Genomics 3(2):83-92	|ERG5 |GCN4
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kontoyiannis DP (2000) Efflux-mediated resistance to fluconazole could be modulated by sterol homeostasis in Saccharomyces cerevisiae. J Antimicrob Chemother 46(2):199-203	|NCP1 |PDR1 |PDR5 |YMR034C
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kontoyiannis DP (2000) Modulation of fluconazole sensitivity by the interaction of mitochondria and erg3p in Saccharomyces cerevisiae. J Antimicrob Chemother 46(2):191-7
Mutants/Phenotypes Protein Processing/Modification/Regulation Regulation of	Launhardt H and Munder T (2000) Post-translational regulation of Saccharomyces cerevisiae proteins tagged with the hormone-binding domains of mammalian nuclear receptors. Mol Gen Genet 264(3):317-24	|ERG11 |RPN5 |SCM3
Mutants/Phenotypes Strains/Constructs	Shitamukai A, et al. (2000) A positive screening for drugs that specifically inhibit the Ca2+-signaling activity on the basis of the growth promoting effect on a yeast mutant with a peculiar phenotype. Biosci Biotechnol Biochem 64(9):1942-6	|ZDS1
Non-Fungal Related Genes/Proteins	Taton M, et al. (2000) Role of highly conserved residues in the reaction catalyzed by recombinant Delta7-sterol-C5(6)-desaturase studied by site-directed mutagenesis. Biochemistry 39(4):701-11
Genomic expression study Regulation of	Dimster-Denk D, et al. (1999) Comprehensive evaluation of isoprenoid biosynthesis regulation in Saccharomyces cerevisiae utilizing the Genome Reporter Matrix. J Lipid Res 40(5):850-60	|ARE1 |ARE2 |BEM1 |BET2 |BET4 |BTS1 |CAT5 |CDC43 |COQ1 |COQ2 |COQ3 |COQ6 |COX10 |ERG1 |MORE
Non-Fungal Related Genes/Proteins	Husselstein T, et al. (1999) Delta7-sterol-C5-desaturase: molecular characterization and functional expression of wild-type and mutant alleles. Plant Mol Biol 39(5):891-906
Mutants/Phenotypes Strains/Constructs	Kaur R and Bachhawat AK (1999) The yeast multidrug resistance pump, Pdr5p, confers reduced drug resistance in erg mutants of Saccharomyces cerevisiae. Microbiology 145 ( Pt 4)():809-18	|CHO1 |ERG2 |ERG4 |ERG6 |PDR5
Mutants/Phenotypes Strains/Constructs	Kennedy MA, et al. (1999) Transcriptional regulation of the squalene synthase gene (ERG9) in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1445(1):110-22	|ERG24 |ERG7 |ERG9 |HAP1 |HAP2 |HAP3 |HAP4 |HAP5 |HMG1 |HMG2 |INO2 |INO4 |YAP1
Function/Process Mutants/Phenotypes Strains/Constructs	Kontoyiannis DP (1999) Genetic analysis of azole resistance by transposon mutagenesis in Saccharomyces cerevisiae. Antimicrob Agents Chemother 43(11):2731-5	|CPR1 |NGG1 |PDR5 |SPT7 |YMR034C
Fungal Related Genes/Proteins	Miyazaki Y, et al. (1999) Cloning, sequencing, expression and allelic sequence diversity of ERG3 (C-5 sterol desaturase gene) in Candida albicans. Gene 236(1):43-51
Function/Process Mutants/Phenotypes Strains/Constructs	Parks LW, et al. (1999) Use of sterol mutants as probes for sterol functions in the yeast, Saccharomyces cerevisiae. Crit Rev Biochem Mol Biol 34(6):399-404
Alias Mutants/Phenotypes Strains/Constructs	Schmidt CL, et al. (1999) Allelism of Saccharomyces cerevisiae genes PSO6, involved in survival after 3-CPs+UVA induced damage, and ERG3, encoding the enzyme sterol C-5 desaturase. Yeast 15(14):1503-10
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Wangspa R and Takemoto JY (1998) Role of ergosterol in growth inhibition of Saccharomyces cerevisiae by syringomycin E. FEMS Microbiol Lett 167(2):215-20
Function/Process Mutants/Phenotypes Strains/Constructs	Palermo LM, et al. (1997) Assessment of the essentiality of ERG genes late in ergosterol biosynthesis in Saccharomyces cerevisiae. Curr Genet 32(2):93-9	|ERG2
Mutants/Phenotypes Strains/Constructs Transcription	Arthington-Skaggs BA, et al. (1996) Positive and negative regulation of a sterol biosynthetic gene (ERG3) in the post-squalene portion of the yeast ergosterol pathway. FEBS Lett 392(2):161-5	|ARE1 |ARE2 |ERG2 |ERG4 |ERG5 |ERG6
Genetic Interactions	Fang M, et al. (1996) Kes1p shares homology with human oxysterol binding protein and participates in a novel regulatory pathway for yeast Golgi-derived transport vesicle biogenesis. EMBO J 15(23):6447-59	|ERG6 |HES1 |HMG1 |HMG2 |KES1 |SEC14 |SWH1
Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Gachotte D, et al. (1996) Isolation and characterization of an Arabidopsis thaliana cDNA encoding a delta 7-sterol-C-5-desaturase by functional complementation of a defective yeast mutant. Plant J 9(3):391-8
Non-Fungal Related Genes/Proteins	Matsushima M, et al. (1996) Molecular cloning and mapping of a human cDNA (SC5DL) encoding a protein homologous to fungal sterol-C5-desaturase. Cytogenet Cell Genet 74(4):252-4
Mutants/Phenotypes Strains/Constructs Transcription	Smith SJ, et al. (1996) Transcriptional regulation by ergosterol in the yeast Saccharomyces cerevisiae. Mol Cell Biol 16(10):5427-32
Function/Process Protein Physical Properties	Barrett-Bee K and Dixon G (1995) Ergosterol biosynthesis inhibition: a target for antifungal agents. Acta Biochim Pol 42(4):465-79	|ERG1 |ERG11 |ERG2 |ERG24
Function/Process Genetic Interactions	Gachotte D, et al. (1995) An Arabidopsis mutant deficient in sterol biosynthesis: heterologous complementation by ERG 3 encoding a delta 7-sterol-C-5-desaturase from yeast. Plant J 8(3):407-16
Non-Fungal Related Genes/Proteins	Geber A, et al. (1995) Deletion of the Candida glabrata ERG3 and ERG11 genes: effect on cell viability, cell growth, sterol composition, and antifungal susceptibility. Antimicrob Agents Chemother 39(12):2708-17	|ERG11
Function/Process Mutants/Phenotypes Strains/Constructs	Hemmi K, et al. (1995) The physiological roles of membrane ergosterol as revealed by the phenotypes of syr1/erg3 null mutant of Saccharomyces cerevisiae. Biosci Biotechnol Biochem 59(3):482-6
Reviews	Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6	|ERG1 |ERG11 |ERG2 |ERG24 |ERG4 |ERG5 |ERG6 |ERG7 |ERG9 |FEN1 |FEN2
Reviews	Parks LW and Casey WM (1995) Physiological implications of sterol biosynthesis in yeast. Annu Rev Microbiol 49:95-116	|ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |ERG4 |ERG5 |ERG6 |ERG7 |ERG8 |MORE
Reviews	Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30	|ERG1 |ERG10 |ERG11 |ERG12 |ERG2 |ERG20 |ERG24 |ERG4 |ERG5 |ERG6 |ERG7 |ERG8 |ERG9 |HMG1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Prendergast JA, et al. (1995) Mutations sensitizing yeast cells to the start inhibitor nalidixic acid. Yeast 11(6):537-47	|ARO7 |ERG6
Mutants/Phenotypes Strains/Constructs	Querol CB, et al. (1994) Isolation and characterization of three mutants with increased sensitivity to photoactivated 3-carbethoxypsoralen in Saccharomyces cerevisiae. Curr Genet 25(5):407-11	|COX11 |RAD16
Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Strains/Constructs	Taguchi N, et al. (1994) Identification and analysis of the Saccharomyces cerevisiae SYR1 gene reveals that ergosterol is involved in the action of syringomycin. Microbiology 140 ( Pt 2):353-9
Function/Process Genetic Interactions Strains/Constructs	Bard M, et al. (1993) Sterol synthesis and viability of erg11 (cytochrome P450 lanosterol demethylase) mutations in Saccharomyces cerevisiae and Candida albicans. Lipids 28(11):963-7	|ERG11 |ERG2 |ERG24
Function/Process Mapping Mutants/Phenotypes Strains/Constructs	Smith SJ and Parks LW (1993) The ERG3 gene in Saccharomyces cerevisiae is required for the utilization of respiratory substrates and in heme-deficient cells. Yeast 9(11):1177-87	|GAL2 |SPT8
Cellular Location Function/Process Reviews	Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|ACC1 |ACH1 |CDS1 |CHO1 |CHO2 |CKI1 |CTR1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |MORE
DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Arthington BA, et al. (1991) Cloning, disruption and sequence of the gene encoding yeast C-5 sterol desaturase. Gene 102(1):39-44
Function/Process Mutants/Phenotypes Strains/Constructs	Lorenz RT and Parks LW (1991) Physiological effects of fenpropimorph on wild-type Saccharomyces cerevisiae and fenpropimorph-resistant mutants. Antimicrob Agents Chemother 35(8):1532-7	|ERG11
Function/Process Mutants/Phenotypes Strains/Constructs	Ekhvalova TV, et al. (1989) [The level of cytochrome P-450 in Saccharomyces cerevisiae with disruptions of various stages of sterol synthesis] Biokhimiia 54(8):1344-7
Other Features	Kamilova TA and Ekhvalova TV (1989) [Resistance of yeasts to polyene antibiotics] Genetika 25(9):1705-7	|ERG4
Function/Process Mutants/Phenotypes Strains/Constructs	Watson PF, et al. (1989) Defective sterol C5-6 desaturation and azole resistance: a new hypothesis for the mode of action of azole antifungals. Biochem Biophys Res Commun 164(3):1170-5
Function/Process Mutants/Phenotypes Strains/Constructs	Watson PF, et al. (1988) Isolation and analysis of ketoconazole resistant mutants of Saccharomyces cerevisiae. J Med Vet Mycol 26(3):153-62
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	McCammon MT, et al. (1984) Sterol methylation in Saccharomyces cerevisiae. J Bacteriol 157(2):475-83	|ERG6
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Rodriguez RJ and Parks LW (1983) Structural and physiological features of sterols necessary to satisfy bulk membrane and sparking requirements in yeast sterol auxotrophs. Arch Biochem Biophys 225(2):861-71
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Taylor FR, et al. (1983) Relationship between antifungal activity and inhibition of sterol biosynthesis in miconazole, clotrimazole, and 15-azasterol. Antimicrob Agents Chemother 23(4):515-21	|ERG11
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Taylor FR, et al. (1983) Requirement for a second sterol biosynthetic mutation for viability of a sterol C-14 demethylation defect in Saccharomyces cerevisiae. J Bacteriol 155(1):64-8	|ERG11
Cellular Location	Nishino T, et al. (1981) Subcellular localization of the enzymes involved in the late stage of ergosterol biosynthesis in yeast. J Biochem 89(5):1391-6	|ERG5
Cellular Location Function/Process Protein Physical Properties Substrates/Ligands/Cofactors	Osumi T, et al. (1979) Studies on the delta 5-desaturation in ergosterol biosynthesis in yeast. J Biochem 85(3):819-26
Function/Process Genetic Interactions Strains/Constructs	Bard M, et al. (1977) Sterol mutants of Saccharomyces cerevisiae: chromatographic analyses. Lipids 12(8):645-54	|ERG2 |ERG5 |ERG6
Function/Process Mutants/Phenotypes Strains/Constructs	Gollub EG, et al. (1974) Yeast mutants requiring ergosterol as only lipid supplement. Biochem Biophys Res Commun 56(2):471-7

Return to SGD

Send a Message to the SGD Curators