GPI13/YLL031C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrXII: 80204 to 77151
CDS: 80204 - 77151

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

GPI13 YLL031C MPC1 ORF, Verified S000003954

Description
ER membrane localized phosphoryltransferase that adds phosphoethanolamine onto the third mannose residue of the glycosylphosphatidylinositol (GPI) anchor precursor; similar to human PIG-O protein

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
catalytic activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR002591 , EBI:IPR017849 , EBI:IPR017850
Assigned on 2008-02-13 UniProtKB
mannose-ethanolamine phosphotransferase activity Toh-e A and Oguchi T (2002) Genetic characterization of genes encoding enzymes catalyzing addition of phospho-ethanolamine to the glycosylphosphatidylinositol anchor in Saccharomyces cerevisiae. Genes Genet Syst 77(5):309-22
       IMP : Inferred from Mutant Phenotype
Assigned on 2006-10-12 SGD
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
transferase activity, transferring phosphorus-containing groups Taron CH, et al. (2000) Glycosylphosphatidylinositol biosynthesis defects in Gpi11p- and Gpi13p-deficient yeast suggest a branched pathway and implicate gpi13p in phosphoethanolamine transfer to the third mannose. Mol Biol Cell 11(5):1611-30
       IMP : Inferred from Mutant Phenotype
Assigned on 2005-03-28 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
GPI anchor biosynthetic process Taron CH, et al. (2000) Glycosylphosphatidylinositol biosynthesis defects in Gpi11p- and Gpi13p-deficient yeast suggest a branched pathway and implicate gpi13p in phosphoethanolamine transfer to the third mannose. Mol Biol Cell 11(5):1611-30
       IMP : Inferred from Mutant Phenotype
Assigned on 2001-01-18 SGD
Toh-e A and Oguchi T (2002) Genetic characterization of genes encoding enzymes catalyzing addition of phospho-ethanolamine to the glycosylphosphatidylinositol anchor in Saccharomyces cerevisiae. Genes Genet Syst 77(5):309-22
       IMP : Inferred from Mutant Phenotype
Assigned on 2006-10-12 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0337
Assigned on 2007-05-23 UniProtKB
cellular cell wall organization GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0961
Assigned on 2008-02-14 UniProtKB
metabolic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR017849 , EBI:IPR017850
Assigned on 2008-04-01 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Taron CH, et al. (2000) Glycosylphosphatidylinositol biosynthesis defects in Gpi11p- and Gpi13p-deficient yeast suggest a branched pathway and implicate gpi13p in phosphoethanolamine transfer to the third mannose. Mol Biol Cell 11(5):1611-30
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2001-01-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forGPI13/YLL031C for GPI13
1) Tohe A and Oguchi T (2000) An improved integration replacement/disruption method for mutagenesis of yeast essential genes. Genes Genet Syst 75(1):33-9

2) Taron CH, et al. (2000) Glycosylphosphatidylinositol biosynthesis defects in Gpi11p- and Gpi13p-deficient yeast suggest a branched pathway and implicate gpi13p in phosphoethanolamine transfer to the third mannose. Mol Biol Cell 11(5):1611-30

3) Flury I, et al. (2000) YLL031c belongs to a novel family of membrane proteins involved in the transfer of ethanolaminephosphate onto the core structure of glycosylphosphatidylinositol anchors in yeast. J Biol Chem 275(32):24458-65

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for GPI13/YLL031C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for GPI13/YLL031C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MDEKTIK

C-term INDIFWK

Length(aa) 1,017

MW(Da) 115,633

pI 6.62

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.134

Codon Adaptation Index 0.165

Frequency of Optimal Codons 0.493

Hydropathicity of Protein 0.281

Aromaticity Score 0.123

10 20 30 40 50 | | | | | MDEKTIKKSILSSSNDEKIIYKSRIKKFQKNHKFYIILLVFIAILQFISI AFFTRGFLLSRHVLDNISSQNETSKLPPRFNKAVILVIDALRFDFAIPVN ESHSNYNLNYHNNILSLYDSFASDKDASSLLLKFIADPPTTTLQRLKGLT TGSLPTFIDAGSNFDGTVIEEDNFLKQLHLANKTVKFAGDDTWMALFHPF LSNDSFPLESLNVWDLDTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHV GHKYGPDHFTMREKQIQVDQFIDWILKSIDDDTLLVILGDHGMDHTGNHG GDSIDELESTLFLYSKKPDMWRLKETSNYNIDNLGHDYRSVRQIDLVSSL ALLMGQPIPFNNLGWPIDEIARNDREWSQFVNSAISQLQLYKDTMQIHHG NDEILEPLAKNISNTPPTSDPEKFVKLGHKYQKVFLQTCEELWAKFDYYS IATGITLLATSLVLLISITKLIPSIVVNQMVPEFVPGIIIMVLVTNLCFH GIFYVYQQPSFVDQFWGTLLATAIGIIIGCYITIFDRYNFIWIAMRLGET LADYWSRIAVMFMIIHALLFTSNSFTIWEDRIVAFLLSTFGMLTLYEFVF LPKRQSTTALLTATISEKEGTTSGVNPSTANSNYLPLTRFARLLGGYHSA VLIIFTRLASMITICREEQGEYCIPTFNNQNNSSWWVLGLCFLMIFILPA CITGYYNLTSSYQAAAPIWINVFLKGILGLNFVYWSLTSLENNSAVIAIP FLRDVTIFKFTLARIIAGFSLIASNVGWLMGPLCIKLNIHNTDVKSHEAT ILGYTNIYGSEFFLLVINVLISILLFNKPLAQLSYFLMCNQLLSILEIID LLKLKENIIGPIALGLLSYQHFFTTGHQATIPSVQWDIGFMLSEKVTFPF TQIAIILNTFGPHILVSLSVALLTLWSQPPDVLKPQTLLGRIVSNCGILL TYNTILCLSSFIWVTHFRRHLMVWKIFCPRFIFASLSLIVTQLVVTFGTI AFASGRLIKHINDIFWK*

Protein Structures from PDB: proteins of known structure with sequence similarity to GPI13/YLL031C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
GPI13 SGD (2007) Information without a citation in SGD

Alias Name(s) Reference
MPC1 Tohe A and Oguchi T (2000) An improved integration replacement/disruption method for mutagenesis of yeast essential genes. Genes Genet Syst 75(1):33-9

Standard Name	Reference
GPI13	SGD (2007) Information without a citation in SGD

Alias Name(s)	Reference
MPC1	Tohe A and Oguchi T (2000) An improved integration replacement/disruption method for mutagenesis of yeast essential genes. Genes Genet Syst 75(1):33-9

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YLL031C SGD Systematic Sequence

850628 NCBI: Gene ID

NP_013069.1 NCBI: RefSeq protein version ID

NP_013069.1 NCBI: RefSeq protein version ID

6322997 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YLL031C	SGD Systematic Sequence
850628	NCBI: Gene ID
NP_013069.1	NCBI: RefSeq protein version ID
NP_013069.1	NCBI: RefSeq protein version ID
6322997	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
19 curated references; 0 references not yet curated
Reviews
Fujita M and Kinoshita T (2009) Structural remodeling of GPI anchors during biosynthesis and after attachment to proteins. FEBS Lett
     |ARV1 |BST1 |CDC1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI14 |GPI15 |GPI16 |MORE
Mutants/Phenotypes
Strains/Constructs
Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
       |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Reviews
Bosson R and Conzelmann A (2007) Multiple functions of inositolphosphorylceramides in the formation and intracellular transport of glycosylphosphatidylinositol-anchored proteins in yeast. Biochem Soc Symp (74):199-209
     |BST1 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |GPI19 |MORE
Evolution
Fungal Related Genes/Proteins
Coronado JE, et al. (2007) Conserved processes and lineage-specific proteins in fungal cell wall evolution. Eukaryot Cell 6(12):2269-77
       |ACF2 |AGA1 |AGA2 |ANS1 |BAR1 |BGL2 |BSC1 |CCW12 |CCW14 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |MORE
Reviews
Orlean P and Menon AK (2007) Thematic review series: lipid posttranslational modifications. GPI anchoring of protein in yeast and mammalian cells, or: how we learned to stop worrying and love glycophospholipids. J Lipid Res 48(5):993-1011
         |BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Reviews
Pittet M and Conzelmann A (2007) Biosynthesis and function of GPI proteins in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):405-20
       |BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Mutants/Phenotypes
Strains/Constructs
Grimme SJ, et al. (2004) Deficiencies in the essential Smp3 mannosyltransferase block glycosylphosphatidylinositol assembly and lead to defects in growth and cell wall biogenesis in Candida albicans. Microbiology 150(Pt 10):3115-28
       |SMP3
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Imhof I, et al. (2004) Glycosylphosphatidylinositol (GPI) proteins of Saccharomyces cerevisiae contain ethanolamine phosphate groups on the alpha1,4-linked mannose of the GPI anchor. J Biol Chem 279(19):19614-27
       |LAS21 |MCD4 |PSD1 |SEC18
Non-Fungal Related Genes/Proteins
Delorenzi M, et al. (2002) Genes for glycosylphosphatidylinositol toxin biosynthesis in Plasmodium falciparum. Infect Immun 70(8):4510-22
         |DPM1 |GAA1 |GPI1 |GPI10 |GPI12 |GPI14 |GPI8 |SPT14
Fungal Related Genes/Proteins
Protein Sequence Features
Richard M, et al. (2002) GPI7 affects cell-wall protein anchorage in Saccharomyces cerevisiae and Candida albicans. Microbiology 148(Pt 7):2125-33
       |LAS21 |MCD4
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Toh-e A and Oguchi T (2002) Genetic characterization of genes encoding enzymes catalyzing addition of phospho-ethanolamine to the glycosylphosphatidylinositol anchor in Saccharomyces cerevisiae. Genes Genet Syst 77(5):309-22
       |DPL1 |ECM33 |FSR2 |LAS21 |MCD4 |PSD1 |PSD2
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Grimme SJ, et al. (2001) The essential Smp3 protein is required for addition of the side-branching fourth mannose during assembly of yeast glycosylphosphatidylinositols. J Biol Chem 276(29):27731-9
       |ALG12 |ALG9 |GAA1 |GPI1 |GPI10 |GPI11 |SMP3
Alias
Mutants/Phenotypes
Toh-e A and Oguchi T (2001) Defects in glycosylphosphatidylinositol (GPI) anchor synthesis activate Hog1 kinase and confer copper-resistance in Saccharomyces cerevisisae. Genes Genet Syst 76(6):393-410
       |HOG1 |LAS21 |MCD4 |PBS2 |SHO1 |SLN1 |SSK1
Cellular Location
Function/Process
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Flury I, et al. (2000) YLL031c belongs to a novel family of membrane proteins involved in the transfer of ethanolaminephosphate onto the core structure of glycosylphosphatidylinositol anchors in yeast. J Biol Chem 275(32):24458-65
       |LAS21 |MCD4
Non-Fungal Related Genes/Proteins
Hong Y, et al. (2000) Requirement of PIG-F and PIG-O for transferring phosphoethanolamine to the third mannose in glycosylphosphatidylinositol. J Biol Chem 275(27):20911-9

Function/Process
Reviews
Kinoshita T and Inoue N (2000) Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis. Curr Opin Chem Biol 4(6):632-8
       |DPM1 |GAA1 |GPI1 |GPI10 |GPI14 |GPI19 |GPI2 |GPI8 |LAS21 |MCD4 |SMP3 |SPT14
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Taron CH, et al. (2000) Glycosylphosphatidylinositol biosynthesis defects in Gpi11p- and Gpi13p-deficient yeast suggest a branched pathway and implicate gpi13p in phosphoethanolamine transfer to the third mannose. Mol Biol Cell 11(5):1611-30
       |GPI11 |LAS21
Alias
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Tohe A and Oguchi T (2000) An improved integration replacement/disruption method for mutagenesis of yeast essential genes. Genes Genet Syst 75(1):33-9

Mutants/Phenotypes
Strains/Constructs
Zhang N, et al. (1999) Disruption of six novel ORFs on the left arm of chromosome XII reveals one gene essential for vegetative growth of Saccharomyces cerevisiae. Yeast 15(12):1287-96
       |FRA1 |IRC19 |RRT7 |TPO1 |YLL032C

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.