PMT4/YJR143C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrX: 700604 to 698316
CDS: 700604 - 698316

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

PMT4 YJR143C ORF, Verified S000003904

Description
Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine/threonine residues; appears to form homodimers in vivo and does not complex with other Pmt proteins; target for new antifungals

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
dolichyl-phosphate-mannose-protein mannosyltransferase activity Immervoll T, et al. (1995) PMT3 and PMT4, two new members of the protein-O-mannosyltransferase gene family of Saccharomyces cerevisiae. Yeast 11(14):1345-51
     IMP : Inferred from Mutant Phenotype
ISS : Inferred from Sequence or structural Similarity
Assigned on 2001-01-18 SGD
GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
     IEA : Inferred from Electronic Annotation with IUBMB:2.4.1.109
Assigned on 2007-05-23 UniProtKB
mannosyltransferase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003342
Assigned on 2007-05-23 UniProtKB
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0328
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
protein amino acid O-linked glycosylation Immervoll T, et al. (1995) PMT3 and PMT4, two new members of the protein-O-mannosyltransferase gene family of Saccharomyces cerevisiae. Yeast 11(14):1345-51
     IMP : Inferred from Mutant Phenotype
ISS : Inferred from Sequence or structural Similarity
Assigned on 2001-01-18 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003342
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9
     TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003342 , EBI:IPR003608 , EBI:IPR016093
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
protein modifications

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forPMT4/YJR143C for PMT4
1) Immervoll T, et al. (1995) PMT3 and PMT4, two new members of the protein-O-mannosyltransferase gene family of Saccharomyces cerevisiae. Yeast 11(14):1345-51

2) Girrbach V and Strahl S (2003) Members of the evolutionarily conserved PMT family of protein O-mannosyltransferases form distinct protein complexes among themselves. J Biol Chem 278(14):12554-62

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PMT4/YJR143C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PMT4/YJR143C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSVPKKR

C-term IELNFSK

Length(aa) 762

MW(Da) 87,966

pI 6.93

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.206

Codon Adaptation Index 0.216

Frequency of Optimal Codons 0.531

Hydropathicity of Protein 0.014

Aromaticity Score 0.159

10 20 30 40 50 | | | | | MSVPKKRNHGKLPPSTKDVDDPSLKYTKAAPKCEQVAEHWLLQPLPEPES RYSFWVTIVTLLAFAARFYKIWYPKEVVFDEVHFGKFASYYLERSYFFDV HPPFAKMMIAFIGWLCGYDGSFKFDEIGYSYETHPAPYIAYRSFNAILGT LTVPIMFNTLKELNFRAITCAFASLLVAIDTAHVTETRLILLDAILIISI AATMYCYVRFYKCQLRQPFTWSWYIWLHATGLSLSFVISTKYVGVMTYSA IGFAAVVNLWQLLDIKAGLSLRQFMRHFSKRLNGLVLIPFVIYLFWFWVH FTVLNTSGPGDAFMSAEFQETLKDSPLSVDSKTVNYFDIITIKHQDTDAF LHSHLARYPQRYEDGRISSAGQQVTGYTHPDFNNQWEVLPPHGSDVGKGQ AVLLNQHIRLRHVATDTYLLAHDVASPFYPTNEEITTVTLEEGDGELYPE TLFAFQPLKKSDEGHVLKSKTVSFRLFHVDTSVALWTHNDELLPDWGFQQ QEINGNKKVIDPSNNWVVDEIVNLDEVRKVYIPKVVKPLPFLKKWIETQK SMFEHNNKLSSEHPFASEPYSWPGSLSGVSFWTNGDEKKQIYFIGNIIGW WFQVISLAVFVGIIVADLITRHRGYYALNKMTREKLYGPLMFFFVSWCCH YFPFFLMARQKFLHHYLPAHLIACLFSGALWEVIFSDCKSLDLEKDEDIS GASYERNPKVYVKPYTVFLVCVSCAVAWFFVYFSPLVYGDVSLSPSEVVS REWFDIELNFSK*

Protein Structures from PDB: proteins of known structure with sequence similarity to PMT4/YJR143C, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to PMT4 Homolog Source (per PDB) Protein Alignment: PMT4 vs. Homolog External Links
P-Value %Identical %Similar Alignment
1t9f ( Chain: A)
Structural genomics of caenorhabditis elegans: structure of a protein with unknown function
PDB_Info
PDB_Structure
Caenorhabditis elegans 2.6e-05 25 33 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
PMT4 SGD (2007) Information without a citation in SGD

Standard Name	Reference
PMT4	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YJR143C SGD Systematic Sequence

853608 NCBI: Gene ID

NP_012677.1 NCBI: RefSeq protein version ID

NP_012677.1 NCBI: RefSeq protein version ID

6322603 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YJR143C	SGD Systematic Sequence
853608	NCBI: Gene ID
NP_012677.1	NCBI: RefSeq protein version ID
NP_012677.1	NCBI: RefSeq protein version ID
6322603	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
30 curated references; 0 references not yet curated
Reviews
Chiba Y and Akeboshi H (2009) Glycan engineering and production of 'humanized' glycoprotein in yeast cells. Biol Pharm Bull 32(5):786-95
       |KTR6 |MNN1 |MNN4 |OCH1 |PMT1 |PMT2 |PMT3 |PMT5 |PMT6
Mutants/Phenotypes
Strains/Constructs
Dupres V, et al. (2009) The yeast Wsc1 cell surface sensor behaves like a nanospring in vivo. Nat Chem Biol 5(11):857-62
     |MID2 |SLG1
Fungal Related Genes/Proteins
Fernandez-Alvarez A, et al. (2009) The O-Mannosyltransferase PMT4 Is Essential for Normal Appressorium Formation and Penetration in Ustilago maydis. Plant Cell 21(10):3397-412
     |KRE2 |MNN1 |MNT4 |PMT1 |PMT2
Mutants/Phenotypes
Murakami-Sekimata A, et al. (2009) O-Mannosylation is required for the solubilization of heterologously expressed human beta-amyloid precursor protein in Saccharomyces cerevisiae. Genes Cells 14(2):205-15
       |PMT1 |PMT2 |SEC12 |SEC18
Fungal Related Genes/Proteins
Willger SD, et al. (2009) Characterization of the PMT gene family in Cryptococcus neoformans. PLoS One 4(7):e6321
           |PMT1 |PMT2
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Yang HY, et al. (2009) Glycosylation defects activate filamentous growth Kss1 MAPK and inhibit osmoregulatory Hog1 MAPK. EMBO J 28(10):1380-91
       |FUS3 |HOG1 |KSS1 |MSB2 |OPY2 |PTP2 |STE11 |STE12 |STE20 |STE4 |STE5 |STE50 |STE7
Mutants/Phenotypes
Strains/Constructs
Hirayama H, et al. (2008) O-Mannosylation is Required for Degradation of the Endoplasmic Reticulum-associated Degradation Substrate Gas1*p via the Ubiquitin/Proteasome Pathway in Saccharomyces cerevisiae. J Biochem 143(4):555-67
     |GAS1 |KRE2 |KTR1 |KTR3 |PEP4 |PMT1 |PMT2 |PMT6 |VPS30 |VPS38
Reviews
Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |MORE
Reviews
Lengeler KB, et al. (2008) Protein-O-mannosyltransferases in virulence and development. Cell Mol Life Sci 65(4):528-44
       |AGA1 |AGA2 |AXL2 |BAR1 |CIS3 |CTS1 |FUS1 |GAS1 |HSP150 |KEX2 |KRE9 |MID2 |PIR1 |PIR3 |MORE
Regulation of
Transcription
van den Brink J, et al. (2008) New insights into the Saccharomyces cerevisiae fermentation switch: dynamic transcriptional response to anaerobicity and glucose-excess. BMC Genomics 9:100
       |ACE2 |ALG7 |ARE1 |AUS1 |BAS1 |DAL5 |DAN1 |DAN4 |DNF2 |FAA4 |FET4 |FHL1 |GCN4 |GLN3 |MORE
Reviews
Goto M (2007) Protein o-glycosylation in fungi: diverse structures and multiple functions. Biosci Biotechnol Biochem 71(6):1415-27
       |BAR1 |CTS1 |GAS1 |HSP150 |KEX2 |KRE2 |KRE9 |KTR1 |KTR3 |PMT1 |PMT2 |PMT3 |PMT5 |PMT6 |MORE
Cellular Location
Disease Gene Related
Function/Process
Hutzler J, et al. (2007) Membrane association is a determinant for substrate recognition by PMT4 protein O-mannosyltransferases. Proc Natl Acad Sci U S A 104(19):7827-32

Computational analysis
Protein-protein Interactions
Larsen P, et al. (2007) A statistical method to incorporate biological knowledge for generating testable novel gene regulatory interactions from microarray experiments. BMC Bioinformatics 8:317
     |CDC45 |HEK2 |HHF1 |HHT1 |HSL1 |HTA1 |HTA2 |HTB1 |HTB2 |HTZ1 |KCC4 |MNN1 |PMT1 |PMT2 |MORE
Cross-species Expression
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Olson GM, et al. (2007) Role of protein O-mannosyltransferase Pmt4 in the morphogenesis and virulence of Cryptococcus neoformans. Eukaryot Cell 6(2):222-34
       |PMT1
Reviews
Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |MORE
Fungal Related Genes/Proteins
Tanaka N, et al. (2005) Characterization of O-mannosyltransferase family in Schizosaccharomyces pombe. Biochem Biophys Res Commun 330(3):813-20
           |PMT1 |PMT2
Fungal Related Genes/Proteins
Willer T, et al. (2005) Protein O-mannosylation is crucial for cell wall integrity, septation and viability in fission yeast. Mol Microbiol 57(1):156-70
         |PMT1 |PMT2
Function/Process
Mutants/Phenotypes
Strains/Constructs
Frieman MB and Cormack BP (2004) Multiple sequence signals determine the distribution of glycosylphosphatidylinositol proteins between the plasma membrane and cell wall in Saccharomyces cerevisiae. Microbiology 150(Pt 10):3105-14
       |FLO1 |FLO9 |KRE2 |KTR1 |KTR3 |MNN1 |MNN9 |PMT1 |PMT2 |PMT3 |PMT5 |PMT6
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Lommel M, et al. (2004) Aberrant processing of the WSC family and Mid2p cell surface sensors results in cell death of Saccharomyces cerevisiae O-mannosylation mutants. Mol Cell Biol 24(1):46-57
       |MID2 |PKC1 |PMT2 |SLG1 |SLT2 |WSC2
Mutants/Phenotypes
Strains/Constructs
Proszynski TJ, et al. (2004) O-glycosylation as a sorting determinant for cell surface delivery in yeast. Mol Biol Cell 15(4):1533-43
       |FUS1
Function/Process
Mutants/Phenotypes
Protein-protein Interactions
Regulatory Role
Substrates/Ligands/Cofactors
Ecker M, et al. (2003) O-mannosylation precedes and potentially controls the N-glycosylation of a yeast cell wall glycoprotein. EMBO Rep 4(6):628-32
       |CIS3 |PMT1 |PMT2
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Protein/Nucleic Acid Structure
Substrates/Ligands/Cofactors
Girrbach V and Strahl S (2003) Members of the evolutionarily conserved PMT family of protein O-mannosyltransferases form distinct protein complexes among themselves. J Biol Chem 278(14):12554-62
       |PMT1 |PMT2 |PMT3 |PMT5
Fungal Related Genes/Proteins
Zakrzewska A, et al. (2003) cDNA encoding protein O-mannosyltransferase from the filamentous fungus Trichoderma reesei; functional equivalence to Saccharomyces cerevisiae PMT2. Curr Genet 43(1):11-6
         |PMT2
Fungal Related Genes/Proteins
Protein Sequence Features
Girrbach V, et al. (2000) Structure-function analysis of the dolichyl phosphate-mannose: protein O-mannosyltransferase ScPmt1p. J Biol Chem 275(25):19288-96
       |PMT1 |PMT2 |PMT3 |PMT5 |PMT6
Function/Process
Fungal Related Genes/Proteins
Romero PA, et al. (1999) Mnt2p and Mnt3p of Saccharomyces cerevisiae are members of the Mnn1p family of alpha-1,3-mannosyltransferases responsible for adding the terminal mannose residues of O-linked oligosaccharides. Glycobiology 9(10):1045-51
       |MNN1 |MNT2 |MNT3 |MNT4 |PMT1 |PMT2 |PMT3 |PMT5 |PMT6
Function/Process
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Sanders SL, et al. (1999) O-Glycosylation of Axl2/Bud10p by Pmt4p is required for its stability, localization, and function in daughter cells. J Cell Biol 145(6):1177-88
       |AXL2
Strains/Constructs
Timpel C, et al. (1998) Multiple functions of Pmt1p-mediated protein O-mannosylation in the fungal pathogen Candida albicans. J Biol Chem 273(33):20837-46
       |PMT1 |PMT2 |PMT3 |PMT5 |PMT6
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Gentzsch M and Tanner W (1997) Protein-O-glycosylation in yeast: protein-specific mannosyltransferases. Glycobiology 7(4):481-6
     |AGA2 |BAR1 |CTS1 |GAS1 |HSP150 |KEX2 |KRE9 |PMT1 |PMT2 |PMT3 |PMT5 |PMT6
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9
     |GAS1 |PMT1 |PMT2 |PMT3 |PMT5 |PMT6 |PMT7
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
RNA Levels and Processing
Strains/Constructs
Substrates/Ligands/Cofactors
Immervoll T, et al. (1995) PMT3 and PMT4, two new members of the protein-O-mannosyltransferase gene family of Saccharomyces cerevisiae. Yeast 11(14):1345-51
     |PMT1 |PMT2 |PMT3

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.