---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

STE24/YJR117W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrX: 641997 to 643358 CDS: 641997 - 643358 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
STE24	YJR117W	AFC1, PIO2	ORF, Verified	S000003878
Description
Highly conserved zinc metalloprotease that functions in two steps of a-factor maturation, C-terminal CAAX proteolysis and the first step of N-terminal proteolytic processing; contains multiple transmembrane spans

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2007-05-23 UniProtKB metal ion binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0479 Assigned on 2007-05-23 UniProtKB metalloendopeptidase activity Boyartchuk VL, et al. (1997) Modulation of Ras and a-factor function by carboxyl-terminal proteolysis. Science 275(5307):1796-800        ISS : Inferred from Sequence or structural Similarity Assigned on 2005-01-03 SGD Tam A, et al. (2001) The multispanning membrane protein Ste24p catalyzes CAAX proteolysis and NH2-terminal processing of the yeast a-factor precursor. J Biol Chem 276(50):46798-806        IDA : Inferred from Direct Assay Assigned on 2002-07-17 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001915 Assigned on 2007-05-23 UniProtKB metallopeptidase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0482 Assigned on 2009-10-01 UniProtKB peptidase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0645 Assigned on 2007-05-23 UniProtKB zinc ion binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0862 Assigned on 2009-10-01 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By CAAX-box protein maturation Boyartchuk VL, et al. (1997) Modulation of Ras and a-factor function by carboxyl-terminal proteolysis. Science 275(5307):1796-800        IMP : Inferred from Mutant Phenotype Assigned on 2009-08-12 SGD peptide pheromone maturation Boyartchuk VL, et al. (1997) Modulation of Ras and a-factor function by carboxyl-terminal proteolysis. Science 275(5307):1796-800        IMP : Inferred from Mutant Phenotype Assigned on 2005-01-03 SGD Tam A, et al. (2001) The multispanning membrane protein Ste24p catalyzes CAAX proteolysis and NH2-terminal processing of the yeast a-factor precursor. J Biol Chem 276(50):46798-806        IDA : Inferred from Direct Assay Assigned on 2002-07-17 SGD proteolysis DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001915 Assigned on 2009-10-01 UniProtKB response to pheromone GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0589 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to endoplasmic reticulum membrane Tam A, et al. (2001) The multispanning membrane protein Ste24p catalyzes CAAX proteolysis and NH2-terminal processing of the yeast a-factor precursor. J Biol Chem 276(50):46798-806        IDA : Inferred from Direct Assay Assigned on 2002-07-17 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001915 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB mitochondrial outer membrane Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50          IDA : Inferred from Direct Assay Assigned on 2006-03-17 SGD nuclear inner membrane Barrowman J, et al. (2008) Analysis of prelamin A biogenesis reveals the nucleus to be a CaaX processing compartment. Mol Biol Cell 19(12):5398-408        IMP : Inferred from Mutant Phenotype Assigned on 2008-11-07 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forSTE24/YJR117W for STE24 1) Tam A, et al. (1998) Dual roles for Ste24p in yeast a-factor maturation: NH2-terminal proteolysis and COOH-terminal CAAX processing. J Cell Biol 142(3):635-49        2) Fujimura-Kamada K, et al. (1997) A novel membrane-associated metalloprotease, Ste24p, is required for the first step of NH2-terminal processing of the yeast a-factor precursor. J Cell Biol 136(2):271-85        3) Tam A, et al. (2001) The multispanning membrane protein Ste24p catalyzes CAAX proteolysis and NH2-terminal processing of the yeast a-factor precursor. J Biol Chem 276(50):46798-806

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for STE24/YJR117W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for STE24/YJR117W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MFDLKTI C-term VSEKKKN Length(aa) 453 MW(Da) 52,324 pI 8.04 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.293   Codon Adaptation Index 0.268   Frequency of Optimal Codons 0.586   Hydropathicity of Protein 0.215   Aromaticity Score 0.148

10 20 30 40 50 | | | | | MFDLKTILDHPNIPWKLIISGFSIAQFSFESYLTYRQYQKLSETKLPPVL EDEIDDETFHKSRNYSRAKAKFSIFGDVYNLAQKLVFIKYDLFPKIWHMA VSLLNAVLPVRFHMVSTVAQSLCFLGLLSSLSTLVDLPLSYYSHFVLEEK FGFNKLTVQLWITDMIKSLTLAYAIGGPILYLFLKIFDKFPTDFLWYIMV FLFVVQILAMTIIPVFIMPMFNKFTPLEDGELKKSIESLADRVGFPLDKI FVIDGSKRSSHSNAYFTGLPFTSKRIVLFDTLVNSNSTDEITAVLAHEIG HWQKNHIVNMVIFSQLHTFLIFSLFTSIYRNTSFYNTFGFFLEKSTGSFV DPVITKEFPIIIGFMLFNDLLTPLECAMQFVMSLISRTHEYQADAYAKKL GYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK KKN*

Protein Structures from PDB: proteins of known structure with sequence similarity to STE24/YJR117W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
STE24	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YJR117W	SGD Systematic Sequence
853581	NCBI: Gene ID
NP_012651.1	NCBI: RefSeq protein version ID
NP_012651.1	NCBI: RefSeq protein version ID
6322577	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
45 curated references; 0 references not yet curated
Non-Fungal Related Genes/Proteins	Barrowman J and Michaelis S (2009) ZMPSTE24, an integral membrane zinc metalloprotease with a connection to progeroid disorders. Biol Chem 390(8):761-73
Strains/Constructs Techniques and Reagents	Clark KM, et al. (2009) Purification of Transmembrane Proteins from Saccharomyces cerevisiae for X-ray Crystallography. Protein Expr Purif	|AAC1 |AAC3 |ADP1 |ALG3 |ALG7 |BOR1 |CHO1 |DGA1 |DPP1 |ENA5 |EPT1 |GPT2 |LPP1 |NFT1 |MORE
Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Follette PJ and Arkowitz RA (2009) Chemotropism during yeast mating. Methods Mol Biol 571:99-110
Genetic Interactions Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Krishnankutty RK, et al. (2009) Proteolytic processing of certain CaaX motifs can occur in the absence of the Rce1p and Ste24p CaaX proteases. Yeast 26(8):451-63	|AXL1 |MFA1 |MOH1 |MRPS8 |NAP1 |PEX19 |POP8 |RCE1 |REC1 |SAM37 |STE14 |STE23 |VPS71 |VTI1 |MORE
Cross-species Expression Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Physical Properties Regulatory Role	Mokry DZ, et al. (2009) Heterologous expression studies of Saccharomyces cerevisiae reveal two distinct trypanosomatid CaaX protease activities and identify their potential targets. Eukaryot Cell 8(12):1891-900	|RAS2 |RCE1 |YDJ1
Cellular Location Non-Fungal Related Genes/Proteins Strains/Constructs	Barrowman J, et al. (2008) Analysis of prelamin A biogenesis reveals the nucleus to be a CaaX processing compartment. Mol Biol Cell 19(12):5398-408	|STE14
Cross-species Expression Non-Fungal Related Genes/Proteins	Bracha-Drori K, et al. (2008) Functional Analysis of Arabidopsis Postprenylation CaaX Processing Enzymes and Their Function in Subcellular Protein Targeting. Plant Physiol 148(1):119-31	|RCE1 |STE14
Fungal Related Genes/Proteins Genetic Interactions	Dixon SJ, et al. (2008) Significant conservation of synthetic lethal genetic interaction networks between distantly related eukaryotes. Proc Natl Acad Sci U S A 105(43):16653-8	|CSM3 |DIA2 |MAK10 |MEC1 |MMS22 |RAD27 |RAD57 |SRS2
Mutants/Phenotypes	Herrero AB, et al. (2008) Levels of SCS7/FA2H-Mediated Fatty Acid 2-Hydroxylation Determine the Sensitivity of Cells to Antitumor PM02734. Cancer Res 68(23):9779-87	|AIM44 |ALD6 |ALG6 |API2 |APL1 |APL5 |APM3 |ATP15 |ATP4 |ATP5 |ATP7 |BRE5 |BST1 |CAT5 |MORE
Protein Physical Properties Substrates/Ligands/Cofactors Techniques and Reagents	Hudon SE, et al. (2008) HIV-protease inhibitors block the enzymatic activity of purified Ste24p. Biochem Biophys Res Commun 374(2):365-8	|STE14
Function/Process	Pu S, et al. (2008) Local coherence in genetic interaction patterns reveals prevalent functional versatility. Bioinformatics 24(20):2376-83	|ASF1 |BRE1 |CDC73 |CTF18 |CTF4 |CTF8 |ELP2 |ELP3 |ELP4 |ELP6 |IRE1 |LGE1 |MMS1 |MMS22 |MORE
Mutants/Phenotypes Strains/Constructs	Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67	|AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Substrates/Ligands/Cofactors	Manandhar SP, et al. (2007) Small-molecule inhibitors of the Rce1p CaaX protease. J Biomol Screen 12(7):983-93	|RCE1 |STE14
Evolution Non-Fungal Related Genes/Proteins	Cai GB, et al. (2006) A membrane-associated metalloprotease of Taenia solium metacestode structurally related to the FACE-1/Ste24p protease family. Int J Parasitol 36(8):925-35
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hallberg M, et al. (2006) Functional and physical interactions within the middle domain of the yeast mediator. Mol Genet Genomics 276(2):197-210	|AIM31 |ASH1 |ERP6 |MED4 |MED6 |MED7 |NUT2 |POP2 |RSM27 |RTA1 |SRB7 |TUP1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Huyer G, et al. (2006) Saccharomyces cerevisiae a-factor mutants reveal residues critical for processing, activity, and export. Eukaryot Cell 5(9):1560-70	|AXL1 |MFA1 |MFA2 |RAM1 |RCE1 |STE14 |STE3 |STE6
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Plummer LJ, et al. (2006) Mutational analysis of the ras converting enzyme reveals a requirement for glutamate and histidine residues. J Biol Chem 281(8):4596-605	|MFA1 |MFA2 |RCE1
Cellular Location	Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50	|AFG1 |AIM18 |ALD4 |ALO1 |ATP15 |ATP2 |ATP3 |ATP5 |AYR1 |BNA4 |CBR1 |CIR1 |COR1 |CYB2 |MORE
Fungal Related Genes/Proteins	Fabre E, et al. (2005) Comparative genomics in hemiascomycete yeasts: evolution of sex, silencing, and subtelomeres. Mol Biol Evol 22(4):856-73	|ABF1 |ASH1 |AXL1 |CDC24 |DOT1 |ESA1 |ESC1 |FAR1 |FUS3 |GCN5 |HMLALPHA1 |HMLALPHA2 |HMRA1 |HMRA2 |MORE
Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Yamashita A, et al. (2005) Roles of C-terminal processing, and involvement in transacylation reaction of human group IVC phospholipase A2 (cPLA2gamma). J Biochem 137(5):557-67
Function/Process Mutants/Phenotypes Strains/Constructs	Jonson L, et al. (2004) Enhanced peptide secretion by gene disruption of CYM1, a novel protease in Saccharomyces cerevisiae. Eur J Biochem 271(23-24):4788-97	|AAP1 |AFG3 |APE2 |APE3 |AXL1 |CYM1 |ECM14 |KAE1 |LAP2 |LAP4 |OCT1 |PRD1 |QRI7 |STE23 |MORE
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Cross-species Expression Disease Gene Related Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Agarwal AK, et al. (2003) Zinc metalloproteinase, ZMPSTE24, is mutated in mandibuloacral dysplasia. Hum Mol Genet 12(16):1995-2001	|RCE1
Non-Fungal Related Genes/Proteins	Cadinanos J, et al. (2003) Identification, functional expression and enzymic analysis of two distinct CaaX proteases from Caenorhabditis elegans. Biochem J 370(Pt 3):1047-54	|RCE1
Cross-species Expression Non-Fungal Related Genes/Proteins	Bracha K, et al. (2002) The Arabidopsis AtSTE24 is a CAAX protease with broad substrate specificity. J Biol Chem 277(33):29856-64
Cellular Location Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes RNA Levels and Processing Strains/Constructs Substrates/Ligands/Cofactors	Tipper DJ and Harley CA (2002) Yeast genes controlling responses to topogenic signals in a model transmembrane protein. Mol Biol Cell 13(4):1158-74	|BMH1 |PMR1 |RCE1 |SPF1 |YPK9
Non-Fungal Related Genes/Proteins	Leung GK, et al. (2001) Biochemical studies of Zmpste24-deficient mice. J Biol Chem 276(31):29051-8	|RCE1
Function/Process Substrates/Ligands/Cofactors	Tam A, et al. (2001) The multispanning membrane protein Ste24p catalyzes CAAX proteolysis and NH2-terminal processing of the yeast a-factor precursor. J Biol Chem 276(50):46798-806
Genetic Interactions Strains/Constructs	Tong AH, et al. (2001) Systematic genetic analysis with ordered arrays of yeast deletion mutants. Science 294(5550):2364-8	|ARC18 |ARC40 |ARP1 |ARP2 |ARP6 |ASE1 |ASF1 |ATS1 |BBC1 |BCK1 |BEM1 |BEM2 |BEM4 |BFA1 |MORE
Alias Function/Process Fungal Related Genes/Proteins	Dolence JM, et al. (2000) Studies with recombinant Saccharomyces cerevisiae CaaX prenyl protease Rce1p. Biochemistry 39(14):4096-104	|RAS2 |RCE1 |RHO2
Cross-species Expression Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Schmidt WK, et al. (2000) Reconstitution of the Ste24p-dependent N-terminal proteolytic step in yeast a-factor biogenesis. J Biol Chem 275(9):6227-33
Other Features Reviews	Sinensky M (2000) Recent advances in the study of prenylated proteins. Biochim Biophys Acta 1484(2-3):93-106	|AXL1 |RAS2 |RCE1 |STE14
Alias Function/Process Fungal Related Genes/Proteins Substrates/Ligands/Cofactors	Trueblood CE, et al. (2000) The CaaX proteases, Afc1p and Rce1p, have overlapping but distinct substrate specificities. Mol Cell Biol 20(12):4381-92	|MFA1 |RCE1 |YGL082W
Genomic expression study Regulation of	Dimster-Denk D, et al. (1999) Comprehensive evaluation of isoprenoid biosynthesis regulation in Saccharomyces cerevisiae utilizing the Genome Reporter Matrix. J Lipid Res 40(5):850-60	|ARE1 |ARE2 |BEM1 |BET2 |BET4 |BTS1 |CAT5 |CDC43 |COQ1 |COQ2 |COQ3 |COQ6 |COX10 |ERG1 |MORE
Mutants/Phenotypes Strains/Constructs	Entian KD, et al. (1999) Functional analysis of 150 deletion mutants in Saccharomyces cerevisiae by a systematic approach. Mol Gen Genet 262(4-5):683-702	|ABM1 |AIM3 |ALT1 |AMN1 |APD1 |APL2 |AVT3 |BIO3 |BIO4 |BIO5 |BNA3 |BUD4 |CFD1 |CHA4 |MORE
Non-Fungal Related Genes/Proteins	Kumagai H, et al. (1999) Identification of a human cDNA encoding a novel protein structurally related to the yeast membrane-associated metalloprotease, Ste24p. Biochim Biophys Acta 1426(3):468-74
Reviews	Ashby MN (1998) CaaX converting enzymes. Curr Opin Lipidol 9(2):99-102	|RCE1
Alias Function/Process Mutants/Phenotypes Strains/Constructs	Boyartchuk VL and Rine J (1998) Roles of prenyl protein proteases in maturation of Saccharomyces cerevisiae a-factor. Genetics 150(1):95-101	|AXL1 |MFA1 |RCE1 |STE23
Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Schmidt WK, et al. (1998) Endoplasmic reticulum membrane localization of Rce1p and Ste24p, yeast proteases involved in carboxyl-terminal CAAX protein processing and amino-terminal a-factor cleavage. Proc Natl Acad Sci U S A 95(19):11175-80	|RAM1 |RAM2 |RCE1 |STE14
Alias Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Tam A, et al. (1998) Dual roles for Ste24p in yeast a-factor maturation: NH2-terminal proteolysis and COOH-terminal CAAX processing. J Cell Biol 142(3):635-49	|AXL1 |MFA1 |MFA2 |RCE1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Boyartchuk VL, et al. (1997) Modulation of Ras and a-factor function by carboxyl-terminal proteolysis. Science 275(5307):1796-800	|MFA1 |MFA2 |RCE1
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Protein Processing/Modification/Regulation Regulation of	Chen P, et al. (1997) A novel a-factor-related peptide of Saccharomyces cerevisiae that exits the cell by a Ste6p-independent mechanism. Mol Biol Cell 8(7):1273-91	|AXL1 |MFA1 |MFA2 |STE6
Fungal Related Genes/Proteins Protein Processing/Modification/Regulation Regulatory Role	Chen P, et al. (1997) Biogenesis of the Saccharomyces cerevisiae mating pheromone a-factor. J Cell Biol 136(2):251-69	|AXL1 |MFA1 |MFA2 |RAM1 |RAM2 |STE14 |STE6
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs Techniques and Reagents	Fujimura-Kamada K, et al. (1997) A novel membrane-associated metalloprotease, Ste24p, is required for the first step of NH2-terminal processing of the yeast a-factor precursor. J Cell Biol 136(2):271-85	|MFA1 |MFA2
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Gelb MH (1997) Protein prenylation, et cetera: signal transduction in two dimensions. Science 275(5307):1750-1	|MFA1 |RAS2 |RCE1

Return to SGD

Send a Message to the SGD Curators