---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

BUD4/YJR092W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrX: 598727 to 603070 CDS: 598727 - 603070 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
BUD4	YJR092W		ORF, Verified	S000003852
Description
Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding; potential Cdc28p substrate

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By GTP binding Sanders SL and Herskowitz I (1996) The BUD4 protein of yeast, required for axial budding, is localized to the mother/BUD neck in a cell cycle-dependent manner. J Cell Biol 134(2):413-27      ISS : Inferred from Sequence or structural Similarity Assigned on 2002-11-25 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By axial cellular bud site selection Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0131 Assigned on 2008-05-01 UniProtKB cell division GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0132 Assigned on 2008-05-01 UniProtKB Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular bud site selection Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-03-02 SGD regulation of cellular catabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT regulation of signal transduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cellular bud neck GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0029 Assigned on 2008-05-01 UniProtKB cellular bud neck contractile ring Madden K and Snyder M (1998) Cell polarity and morphogenesis in budding yeast. Annu Rev Microbiol 52():687-744        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forBUD4/YJR092W for BUD4 1) Chant J and Herskowitz I (1991) Genetic control of bud site selection in yeast by a set of gene products that constitute a morphogenetic pathway. Cell 65(7):1203-12        2) Sanders SL and Herskowitz I (1996) The BUD4 protein of yeast, required for axial budding, is localized to the mother/BUD neck in a cell cycle-dependent manner. J Cell Biol 134(2):413-27

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BUD4/YJR092W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BUD4/YJR092W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MHDAEST C-term NLKQDFN Length(aa) 1,447 MW(Da) 164,485 pI 4.58 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.060   Codon Adaptation Index 0.150   Frequency of Optimal Codons 0.456   Hydropathicity of Protein -0.888   Aromaticity Score 0.068

10 20 30 40 50 | | | | | MHDAESTVDSLLKEIDNEMEQTKSNITQNGSEDTPHNWKLPLQEIGDDTM EMLVKHNTRSNATENSRGRSPSKMSTISNESLNLGLLRVNSELEESPAAV HQERIKNSVANGALGHANSPKVLNNLKNMAQDIDKLARDEEKPVKLSSSP LKFTLKSTQPLLSYPESPIHRSSIEIETNYDDEDEEEEDAYTCLTQSPQI LHSPSRIPITNAVSINKLNLDFTLNPNESDKSLVSDTSVDSTGRELDTKT IPELPFCMSSTPEMTPVDEKCNLPSKLLNTSNNSHSDSRSPTASVEDLNI STNLPGADSSQNNPVTTDADALIENDVVRDLQQNMEHIDDAFDEKKVLDE GCSNEPVTFLGENDTRSIVYSNKGTNANVQEFSQEDSLAHSEPKFKDLNA TSDDVWNEDKETDANISTSTKSEESYIADYKVTRQEDWDTKKLHQESEHA NEQPAIIPQKDSSEETFTELNNESEFQRNFKDGEEYRIVQHEESLYGQRT KSPEENIINGSEIGVDHGEAAEVNEPLAKTSAEEHDLSSSCEDQSVSEAR NKDRIEEKEVETKDENIETEKDESEYHKVEENEEPEHVPLLPPLPRWEEI QFNEPFIDENDTSNDSIDLTRSMKPSDYISIWHIQEEEIKSNSPESIANS QFSQQSSITTASTVDSKKDNGSTSFKFKPRIVSRSRIYNPKSRVSSLNYY DNEDYILSNSEWNALDPMRRNTLISKRIQDNIRTQKGHAPLIRPSIMKLN GEDSGFQNHFLEVEQPQEHENIPLSTHLSEQDITTNVGLDEQKLPTNTQD EAEISIREIESAGDITFNRGDLLSLSFDEELGQDFANFLDALDHDSTSFN HGPDDSSSFQRDSSKKSFNSLWESSYELKPPPSIRKQPIAPDVLQKLLES DTKDDADLEKIREERITEPRTGLGIGMLKTPVKDVSIALAASIKGYEASF SDTDSRPEGMNNSDAITLNMFDDFEEDKMTPSTPVRSISPIKRHVSSPFK VVKAGNKQENNEINIKAEEEIEPMTQQETDGLKQDIPPLLAQTKDNVEAK EETITQLEEPQDVEQEFPDMGTLYLSIKAISTLALYGTKSHRATYAIVFD NGENVVQTPWESLPYDGNIRINKEFELPIDFKGKAETSSASSERDSYKKC VITLKCKYEKPRHELVEIVDKVPVGKSFFGKTKYKFEKKYVQKKPKQDEW DYLFAQDGSFARCEIEINEEFLKNVAFNTSHMHYNMINKWSRIADKIHGS KRLYELPRKAPHKVASLDVEACFLERTSAFEQFPKQFSLVNKIVSKYKLQ QNIYKEGYLLQDGGDLKGKIENRFFKLHGSQLSGYHEISRKAKIDINLLK VTKVLRNEDIQADNGGQRNFTDWVLFNECFQLVFDDGERITFNAECSNEE KSDWYNKLQEVVELNVFHQPWVKKYCEKLAEEEKTRTTGHNLKQDFN*

Protein Structures from PDB: proteins of known structure with sequence similarity to BUD4/YJR092W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
BUD4	Chant J and Herskowitz I (1991) Genetic control of bud site selection in yeast by a set of gene products that constitute a morphogenetic pathway. Cell 65(7):1203-12

Sequence Annotation Notes

Date	Note
2004-04-20	Based on the automated comparison of closely related Saccharomyces species by Kellis et al., the start site for BUD4/YJR092W was moved 384 nt upstream. Evidence supporting this change: 1) This is the predicted start methionine in S. paradoxus, S. mikatae, and S. bayanus orthologs; 2) Significant sequence conservation begins abruptly at this ATG. 3) Sanders and Herskowitz 1996 reported cloning and sequencing the BUD4 gene. Their sequence, GenBank accession number U41641, predicts a protein sequence beginning at the same place (starting with the peptide sequence MHDAE) as in the other three species and with a high level of similarity to them; 4) MIPS also annotates the protein sequence for this ORF as beginning at the earlier possible start site. Sanders SL and Herskowitz I (1996) The BUD4 protein of yeast, required for axial budding, is localized to the mother/BUD neck in a cell cycle-dependent manner. J Cell Biol 134(2):413-27      Kellis M, et al. (2003) Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54
2008-06-04	John Koschwanez from Andrew Murray's lab at Harvard University sequenced BUD4/YJR092W in the S288C background and noted errors in the systematic reference sequence. As a result, the following corrections were made to the sequence of Chromosome 10 within BUD4/YJR092W: change A to T at 599750, delete A at 599715, delete A at 599640, delete A at 599597. New: 841 AGTAACAATTCACATTCTGATTCAAGATC-GCCAACAGCCTCTGTGGAGGATTTAAACAT 899 ||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||| Old: 599568 AGTAACAATTCACATTCTGATTCAAGATCAGCCAACAGCCTCTGTGGAGGATTTAAACAT 599627 New: 900 TTCAACGAATCT-GCCGGGTGCTGATTCCAGCCAAAATAATCCAGTCACTACTGATGCGG 958 |||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||| Old: 599628 TTCAACGAATCTAGCCGGGTGCTGATTCCAGCCAAAATAATCCAGTCACTACTGATGCGG 599687 New: 959 ATGCGCTTATTGAAAACGATGTTGTGC-GGGACCTTCAACAGAATATGGAACATATCGAT 1017 ||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||| Old: 599688 ATGCGCTTATTGAAAACGATGTTGTGCAGGGACCTTCAACAGAATATGGAACATATCGAT 599747 New: 1018 GATGCTTTTGATGAGAAAAAAGTTCTTGACGAAGGTTGCAGCAATGAGCCCGTTACCTTT 1077 || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Old: 599748 GAAGCTTTTGATGAGAAAAAAGTTCTTGACGAAGGTTGCAGCAATGAGCCCGTTACCTTT 599807 Koschwanez J and Murray A (2008)
1997-07-27	Three separate single nucleotide deletions were made in the systematic sequence in the region upstream of the ORF BUD4/YJR092W. The T at 598510 was deleted, as was the G at 598678, and the A at 598745. In addition, a single nucleotide transition was made within BUD4/YJR092W. The A at 601831 was changed to a G. New: 598501 ACGCAAAAT-GGTTCCGAAGATACACCACACAACTGGAAGCTTCCGCTGCAGGAAATAGG 598559 ||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| Old: 598501 ACGCAAAATTGGTTCCGAAGATACACCACACAACTGGAAGCTTCCGCTGCAGGAAATAGG 598560 New: 598620 TAGAGGTCGATCACCTTCTAAGATGTCTACCATCTCAAATGAAAGCCTTAATTTGGG-TC 598678 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || Old: 598621 TAGAGGTCGATCACCTTCTAAGATGTCTACCATCTCAAATGAAAGCCTTAATTTGGGGTC 598680 New: 598739 AAAA-CTCTGTTGCCAACGGGGCACTTGGTCATGCCAATTCTCCCAAAGTGCTTAATAAT 598797 |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||| Old: 598741 AAAAACTCTGTTGCCAACGGGGCACTTGGTCATGCCAATTCTCCCAAAGTGCTTAATAAT 598800 New: 601798 TTTGAATTGCCCATAGATTTTAAAGGAAAAGCCGAAACATCCTCCGCTTCTTCTGAAAGA 601857 |||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||| Old: 601801 TTTGAATTGCCCATAGATTTTAAAGGAAAAACCGAAACATCCTCCGCTTCTTCTGAAAGA 601860

Mapping Notes

Date

Note

1998-11-10

Edition 15: Note that there are several sequence differences between the systematic sequence and the sequence submitted by Sylvia Sanders in Genbank [U41641]. The ORF called from the systematic sequence [which is the SGD sequence] is smaller than the ORF in Genbank entry U41641. Cherry JM, et al. (1998) "Genetic and Physical Maps of Saccharomyces cerevisiae (Edition 15)". Pp. 414-420 in 1998 Yeast Genetics and Molecular Biology Meeting Program and Abstracts. Bethesda, MD: The Genetics Society of America

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YJR092W	SGD Systematic Sequence
853554	NCBI: Gene ID
NP_012625.2	NCBI: RefSeq protein version ID
NP_012625.2	NCBI: RefSeq protein version ID
46562091	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
Protein Details Topic Research Highlight Reference Contributor Protein Modification Description: Identified as an efficient substrate of Clb2-Cdk1-as1 in a screen of a proteomic GST-fusion library. Modification Type: Phosphorylation Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64          Jeff Ubersax 2004-01-27

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
43 curated references; 0 references not yet curated
Regulation of Transcription	Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461	|AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
Reviews	Slaughter BD, et al. (2009) Symmetry breaking in the life cycle of the budding yeast. Cold Spring Harbor Perspect Biol 1(3):a003384	|AXL1 |AXL2 |BEM1 |BNI1 |BNR1 |BUD2 |BUD3 |BUD5 |BUD8 |BUD9 |CDC24 |CDC42 |FAR1 |RAX1 |MORE
Mutants/Phenotypes	Watanabe M, et al. (2009) Comprehensive and quantitative analysis of yeast deletion mutants defective in apical and isotropic bud growth. Curr Genet 55(4):365-80	|ACT1 |ADA2 |AKR1 |ARC18 |ARP5 |ARP6 |ARP8 |ASF1 |BNR1 |BUD13 |CCR4 |CDC73 |CLB2 |COG1 |MORE
Cellular Location	Zou J, et al. (2009) Regulation of cell polarity through phosphorylation of Bni4 by Pho85 G1 cyclin-dependent kinases in Saccharomyces cerevisiae. Mol Biol Cell 20(14):3239-50	|AIM44 |APL3 |AXL1 |BCK1 |BEM1 |BEM2 |BNI1 |BNI4 |BNR1 |BOI1 |BOP3 |BUD22 |BUD3 |CDC10 |MORE
Regulatory Role	Barrales RR, et al. (2008) Identification of Novel Activation Mechanisms for FLO11 Regulation in Saccharomyces cerevisiae. Genetics 178(1):145-56	|ARP7 |ASH1 |ATP10 |ENA1 |FLO8 |GAL11 |GPH1 |KRE11 |MSN1 |MSS1 |MSS11 |MUC1 |PHO23 |RDR1 |MORE
Fungal Related Genes/Proteins Protein-Nucleic Acid Interactions Regulation of	Tuch BB, et al. (2008) The evolution of combinatorial gene regulation in fungi. PLoS Biol 6(2):e38	|ARG81 |ASE1 |ASG7 |BAR1 |CDC20 |CDC5 |CDC6 |CHS2 |CLN3 |FKH2 |MATALPHA1 |MCM1 |RAP1 |STE2 |MORE
Protein Sequence Features	Chang EJ, et al. (2007) Prediction of cyclin-dependent kinase phosphorylation substrates. PLoS One 2(7):e656	|ACC1 |ACE2 |ACM1 |ADY3 |AFI1 |ALY2 |ASE1 |ASH1 |BCK1 |BEM3 |BNI1 |BNI4 |BOI1 |BUD3 |MORE
Cell Cycle Phase Involved Protein-protein Interactions	Gao XD, et al. (2007) Sequential and distinct roles of the cadherin domain-containing protein Axl2p in cell polarization in yeast cell cycle. Mol Biol Cell 18(7):2542-60	|AXL2 |BEM1 |BUD3 |CDC24 |CDC42 |CLA4 |GIC2 |GIN4 |RSR1 |SWE1
Reviews	Park HO and Bi E (2007) Central roles of small GTPases in the development of cell polarity in yeast and beyond. Microbiol Mol Biol Rev 71(1):48-96	|ACT1 |AXL1 |AXL2 |BEM1 |BEM2 |BEM3 |BNI1 |BUD2 |BUD3 |BUD5 |BUD8 |BUD9 |CDC10 |CDC11 |MORE
Regulation of Transcription	Fry RC, et al. (2006) The DNA-damage signature in Saccharomyces cerevisiae is associated with single-strand breaks in DNA. BMC Genomics 7():313	|AAH1 |AHP1 |ALG14 |AMN1 |ASF1 |BAT1 |CAC2 |CAR1 |CDC42 |CDC8 |CHA1 |CHS2 |CIC1 |CLB1 |MORE
RNA Levels and Processing	Guo Y, et al. (2006) Analysis of cellular responses to aflatoxin B(1) in yeast expressing human cytochrome P450 1A2 using cDNA microarrays. Mutat Res 593(1-2):121-42	|AAT1 |AHA1 |ALD2 |ALD3 |ALK1 |APC1 |APC5 |APT2 |AQR1 |AQY2 |ARC40 |ARN1 |ARO10 |ARO9 |MORE
Protein-protein Interactions	Smolka MB, et al. (2006) An FHA domain-mediated protein interaction network of Rad53 reveals its role in polarized cell growth. J Cell Biol 175(5):743-53	|ASF1 |BUD14 |BUD3 |CDC10 |CDC11 |CDC12 |CDC3 |CRP1 |CST6 |ECM16 |ESC1 |FYV8 |GLN3 |IFH1 |MORE
Protein Processing/Modification/Regulation Techniques and Reagents	Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48	|AAC1 |AAC3 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |MORE
Fungal Related Genes/Proteins Protein Sequence Features	Budovskaya YV, et al. (2005) An evolutionary proteomics approach identifies substrates of the cAMP-dependent protein kinase. Proc Natl Acad Sci U S A 102(39):13933-8	|ACA1 |AIM22 |ATG1 |ATG13 |ATG18 |AVT1 |BCY1 |CKI1 |CST6 |DAM1 |ECM3 |FRA1 |IFH1 |IKS1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gladfelter AS, et al. (2005) Interplay between septin organization, cell cycle and cell shape in yeast. J Cell Sci 118(Pt 8):1617-28	|BNI1 |BNI4 |BNR1 |BUD3 |BUD5 |CDC12 |CDC42 |CLN1 |CLN2 |SWE1
Protein Processing/Modification/Regulation	Gruhler A, et al. (2005) Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway. Mol Cell Proteomics 4(3):310-27	|ADR1 |AFR1 |AHP1 |BEM3 |BOI2 |CDC15 |CDC19 |CDC28 |CHD1 |COG3 |CRP1 |CUE2 |CYR1 |DBF2 |MORE
Fungal Related Genes/Proteins	Lee SA, et al. (2005) Intracellular trafficking of fluorescently tagged proteins associated with pathogenesis in Candida albicans. Med Mycol 43(5):423-30	|BPT1 |CDC10 |FTR1 |PDR5 |SEC4 |YCF1 |YPT1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Voth WP, et al. (2005) ACE2, CBK1, and BUD4 in budding and cell separation. Eukaryot Cell 4(6):1018-28	|ACE2 |CBK1 |CTS1 |DSE2 |EGT2 |HYM1 |KIC1 |MOB2 |SCW11 |SWI5
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Fujita A, et al. (2004) Rax1, a protein required for the establishment of the bipolar budding pattern in yeast. Gene 327(2):161-9	|AXL1 |AXL2 |BUD3 |BUD5 |BUD8 |BUD9 |RAX1
DNA/RNA Sequence Features Regulation of	Kreiman G (2004) Identification of sparsely distributed clusters of cis-regulatory elements in sets of co-expressed genes. Nucleic Acids Res 32(9):2889-900	|ACE2 |AIM20 |ALK1 |APC1 |BUD3 |BUD8 |CDC20 |CDC5 |CHS2 |CLB1 |CLB2 |HOF1 |HST3 |IQG1 |MORE
Cellular Location Protein Sequence Features Substrates/Ligands/Cofactors	Yu JW, et al. (2004) Genome-wide analysis of membrane targeting by S. cerevisiae pleckstrin homology domains. Mol Cell 13(5):677-88	|ASK10 |ATG26 |BEM2 |BEM3 |BOI1 |BOI2 |CAF120 |CDC24 |CLA4 |NUM1 |OPY1 |OSH2 |OSH3 |RGC1 |MORE
Fungal Related Genes/Proteins	Berlin A, et al. (2003) Mid2p stabilizes septin rings during cytokinesis in fission yeast. J Cell Biol 160(7):1083-92
DNA/RNA Sequence Features	Tamada Y, et al. (2003) Estimating gene networks from gene expression data by combining Bayesian network model with promoter element detection. Bioinformatics 19 Suppl 2:II227-II236	|ACE2 |ALK1 |ARG2 |CHA4 |CLB2 |GAL11 |HOF1 |REB1 |SUR7 |SWI5 |SWI6
Protein Processing/Modification/Regulation Regulation of	Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64	|ACE2 |ACF4 |ACM1 |ADY3 |ALY2 |ARG1 |ASE1 |ASH1 |ATG20 |AXL2 |BBP1 |BCK2 |BEM1 |BEM3 |MORE
Cellular Location Function/Process RNA Levels and Processing	Cullen PJ and Sprague GF Jr (2002) The roles of bud-site-selection proteins during haploid invasive growth in yeast. Mol Biol Cell 13(9):2990-3004	|AXL1 |AXL2 |BUD2 |BUD3 |BUD8 |SNF1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Lord M, et al. (2002) Subcellular localization of Axl1, the cell type-specific regulator of polarity. Curr Biol 12(15):1347-52	|AXL1 |AXL2 |BUD3 |BUD5
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Osman MA, et al. (2002) Iqg1p links spatial and secretion landmarks to polarity and cytokinesis. J Cell Biol 159(4):601-11	|CDC12 |IQG1 |SEC3
Function/Process Regulation of	Schmidt M, et al. (2002) In budding yeast, contraction of the actomyosin ring and formation of the primary septum at cytokinesis depend on each other. J Cell Sci 115(Pt 2):293-302	|BUD3 |CHS2 |CHS3 |MYO1 |SPA2
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Sundstrom P (2002) Adhesion in Candida spp. Cell Microbiol 4(8):461-9
Fungal Related Genes/Proteins	Gale C, et al. (2001) Candida albicans Int1p interacts with the septin ring in yeast and hyphal cells. Mol Biol Cell 12(11):3538-49	|CDC11 |CDC12 |CDC3 |GIN4 |HSL1 |MYO1 |SWE1
Cell Cycle Phase Involved RNA Levels and Processing Regulation of	Simon I, et al. (2001) Serial regulation of transcriptional regulators in the yeast cell cycle. Cell 106(6):697-708	|ACE2 |AGA1 |AGA2 |ALK1 |APC1 |ARP7 |ASH1 |BUD8 |BUD9 |CDC20 |CDC21 |CDC45 |CDC6 |CHS1 |MORE
Function/Process Mutants/Phenotypes Regulation of Strains/Constructs	Palecek SP, et al. (2000) Genetic analysis reveals that FLO11 upregulation and cell polarization independently regulate invasive growth in Saccharomyces cerevisiae. Genetics 156(3):1005-23	|ADH1 |ARO7 |AXL1 |AXL2 |BEM2 |BPL1 |BUD3 |CDC53 |CSE2 |DIA1 |DIA2 |DIA3 |DIA4 |ELM1 |MORE
Reviews	Pruyne D and Bretscher A (2000) Polarization of cell growth in yeast. J Cell Sci 113 ( Pt 4):571-85	|ABP1 |ACT1 |AIP1 |ARC15 |ARC18 |ARC19 |ARC35 |ARC40 |ARP2 |ARP3 |AXL2 |BEM1 |BNI1 |BNI4 |MORE
Mutants/Phenotypes Strains/Constructs	Entian KD, et al. (1999) Functional analysis of 150 deletion mutants in Saccharomyces cerevisiae by a systematic approach. Mol Gen Genet 262(4-5):683-702	|ABM1 |AIM3 |ALT1 |AMN1 |APD1 |APL2 |AVT3 |BIO3 |BIO4 |BIO5 |BNA3 |CFD1 |CHA4 |CMC1 |MORE
Cellular Location	Frazier JA, et al. (1998) Polymerization of purified yeast septins: evidence that organized filament arrays may not be required for septin function. J Cell Biol 143(3):737-49	|CDC10 |CDC11 |CDC12 |CDC3
Function/Process Mutants/Phenotypes Strains/Constructs	Yang S, et al. (1997) A role for the actin cytoskeleton of Saccharomyces cerevisiae in bipolar bud-site selection. J Cell Biol 136(1):111-23	|ABP1 |ACT1 |AXL1 |AXL2 |BUD8 |BUD9 |MAD2 |SAC6 |SLA1 |SLA2 |SPA2 |SRV2
Function/Process Fungal Related Genes/Proteins	Halme A, et al. (1996) Bud10p directs axial cell polarization in budding yeast and resembles a transmembrane receptor. Curr Biol 6(5):570-9	|AXL2 |BUD3
Cell Cycle Phase Involved Cellular Location DNA/RNA Sequence Features Function/Process Genetic Interactions Protein Processing/Modification/Regulation Protein Sequence Features Strains/Constructs Techniques and Reagents	Sanders SL and Herskowitz I (1996) The BUD4 protein of yeast, required for axial budding, is localized to the mother/BUD neck in a cell cycle-dependent manner. J Cell Biol 134(2):413-27	|BUD3 |CDC12
Function/Process Genetic Interactions Mutants/Phenotypes	Fujita A, et al. (1994) A yeast gene necessary for bud-site selection encodes a protein similar to insulin-degrading enzymes. Nature 372(6506):567-70	|AXL1 |BUD5
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gimeno CJ and Fink GR (1994) Induction of pseudohyphal growth by overexpression of PHD1, a Saccharomyces cerevisiae gene related to transcriptional regulators of fungal development. Mol Cell Biol 14(3):2100-12	|FLO8 |MBP1 |MSN1 |PHD1 |PHD3 |PHD4 |PHD6 |PHD7 |SWI4
Function/Process Fungal Related Genes/Proteins	Park HO, et al. (1993) BUD2 encodes a GTPase-activating protein for Bud1/Rsr1 necessary for proper bud-site selection in yeast. Nature 365(6443):269-74	|BUD2 |BUD3 |BUD5 |CDC25 |RSR1
Function/Process Regulatory Role	Wright RM, et al. (1993) Reversible pseudohyphal growth in haploid Saccharomyces cerevisiae is an aerobic process. Curr Genet 23(5-6):388-91	|BUD3
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Chant J and Herskowitz I (1991) Genetic control of bud site selection in yeast by a set of gene products that constitute a morphogenetic pathway. Cell 65(7):1203-12	|BUD2 |BUD3 |RSR1

Return to SGD

Send a Message to the SGD Curators