OPI3/YJR073C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrX: 572927 to 572307
CDS: 572927 - 572307

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

OPI3 YJR073C PEM2 ORF, Verified S000003834

Description
Phospholipid methyltransferase (methylene-fatty-acyl-phospholipid synthase), catalyzes the last two steps in phosphatidylcholine biosynthesis

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
N-methyltransferase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007318
Assigned on 2007-05-23 UniProtKB
methylene-fatty-acyl-phospholipid synthase activity GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
     IEA : Inferred from Electronic Annotation with IUBMB:2.1.1.16
Assigned on 2007-05-23 UniProtKB
methyltransferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0489
Assigned on 2007-05-23 UniProtKB
phosphatidyl-N-methylethanolamine N-methyltransferase activity Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   TAS : Traceable Author Statement
Assigned on 2003-01-14 SGD
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cellular carbohydrate metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
cellular cell wall organization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
phosphatidylcholine biosynthetic process Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   TAS : Traceable Author Statement
Assigned on 2001-01-19 SGD
phospholipid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0594
Assigned on 2007-05-23 UniProtKB
phospholipid metabolic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR007318
Assigned on 2007-05-23 UniProtKB
vacuolar protein catabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   TAS : Traceable Author Statement
Assigned on 2001-01-19 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2008-04-01 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-06-29 UniProtKB
mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
         IDA : Inferred from Direct Assay
Assigned on 2004-09-28 SGD
Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
           IDA : Inferred from Direct Assay
Assigned on 2006-12-12 SGD

Pathways [TOP] [NEXT]
phosphatidic acid and phospholipid biosynthesis
phospholipid biosynthesis
superpathway of phospholipid biosynthesis

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forOPI3/YJR073C for OPI3
1) Kodaki T and Yamashita S (1987) Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes. J Biol Chem 262(32):15428-35

2) Kodaki T and Yamashita S (1989) Characterization of the methyltransferases in the yeast phosphatidylethanolamine methylation pathway by selective gene disruption. Eur J Biochem 185(2):243-51

3) McGraw P and Henry SA (1989) Mutations in the Saccharomyces cerevisiae opi3 gene: effects on phospholipid methylation, growth and cross-pathway regulation of inositol synthesis. Genetics 122(2):317-30

4) Greenberg ML, et al. (1982) Regulatory mutations of inositol biosynthesis in yeast: isolation of inositol-excreting mutants. Genetics 100(1):19-33

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for OPI3/YJR073C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for OPI3/YJR073C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MKESVQE

C-term DKAKKNM

Length(aa) 206

MW(Da) 23,150

pI 9.6

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.264

Codon Adaptation Index 0.173

Frequency of Optimal Codons 0.560

Hydropathicity of Protein 0.221

Aromaticity Score 0.121

10 20 30 40 50 | | | | | MKESVQEIIQQLIHSVDLQSSKFQLAIVCTMFNPIFWNIVARMEYHKHSL TKMCGGARKGCYMLAATIFSLGIVRDMVYESALREQPTCSLITGENWTKL GVALFGLGQVLVLSSMYKLGITGTYLGDYFGILMDERVTGFPFNVSNNPM YQGSTLSFLGIALYKGKPAGLVVSAVVYFMYKIALRWEEPFTAMIYANRD KAKKNM*

Protein Structures from PDB: proteins of known structure with sequence similarity to OPI3/YJR073C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
OPI3 SGD (2007) Information without a citation in SGD

Alias Name(s) Reference
PEM2 Kodaki T and Yamashita S (1987) Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes. J Biol Chem 262(32):15428-35

Kodaki T and Yamashita S (1989) Characterization of the methyltransferases in the yeast phosphatidylethanolamine methylation pathway by selective gene disruption. Eur J Biochem 185(2):243-51

Standard Name	Reference
OPI3	SGD (2007) Information without a citation in SGD

Alias Name(s)	Reference
PEM2	Kodaki T and Yamashita S (1987) Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes. J Biol Chem 262(32):15428-35 Kodaki T and Yamashita S (1989) Characterization of the methyltransferases in the yeast phosphatidylethanolamine methylation pathway by selective gene disruption. Eur J Biochem 185(2):243-51

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YJR073C SGD Systematic Sequence

853536 NCBI: Gene ID

NP_012607.1 NCBI: RefSeq protein version ID

NP_012607.1 NCBI: RefSeq protein version ID

6322533 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YJR073C	SGD Systematic Sequence
853536	NCBI: Gene ID
NP_012607.1	NCBI: RefSeq protein version ID
NP_012607.1	NCBI: RefSeq protein version ID
6322533	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
93 curated references; 0 references not yet curated
Mutants/Phenotypes
Strains/Constructs
Burston HE, et al. (2009) Regulators of yeast endocytosis identified by systematic quantitative analysis. J Cell Biol 185(6):1097-110
       |ABP1 |ADE12 |AIM21 |AIP1 |APL1 |ARC18 |ATG20 |BBC1 |BZZ1 |CAP1 |CAP2 |CHC1 |CHO2 |CLC1 |MORE
Reviews
Eide DJ (2009) Homeostatic and Adaptive Responses to Zinc Deficiency in Saccharomyces cerevisiae. J Biol Chem 284(28):18565-9
       |ADH1 |ADH2 |ADH3 |ADH4 |CHO1 |CHO2 |CKI1 |CTT1 |DPP1 |EKI1 |FET4 |HPF1 |MCD4 |MET14 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Garbarino J, et al. (2009) Sterol and diacylglycerol acyltransferase deficiency triggers fatty acid-mediated cell death. J Biol Chem 284(45):30994-1005
       |ARE1 |ARE2 |BFR1 |CHO2 |DGA1 |DGK1 |GET1 |GET2 |GET3 |ICE2 |LRO1 |RDL1 |SFB2 |TSC3
Reviews
Petrossian T and Clarke S (2009) Bioinformatic identification of novel methyltransferases Epigenomics 1(1):163-175
   |ABD1 |ABP140 |AML1 |BIO2 |BUD23 |CHO2 |COQ3 |COQ5 |CRG1 |CTM1 |DIM1 |DOT1 |DPH5 |ELP3 |MORE
Transcription
Pinson B, et al. (2009) Metabolic intermediates selectively stimulate transcription factor interaction and modulate phosphate and purine pathways. Genes Dev 23(12):1399-407
       |ADE1 |ADE12 |ADE13 |ADE16 |ADE17 |ADE2 |ADE3 |ADE4 |ADE5,7 |ADE6 |ADE8 |BAS1 |BDH1 |BNA2 |MORE
Alias
Reviews
Riekhof WR and Voelker DR (2009) The yeast plasma membrane P(4)-ATPases are major transporters for lysophospholipids. Biochim Biophys Acta 1791(7):620-7
       |CDC50 |CHO1 |CHO2 |DNF1 |DNF2 |DNF3 |DRS2 |LEM3 |NEO1 |PDS1 |RET1 |YNR048W
Regulation of
Schuck S, et al. (2009) Membrane expansion alleviates endoplasmic reticulum stress independently of the unfolded protein response. J Cell Biol 187(4):525-36
       |HAC1 |INO1 |INO2 |INO4 |IRE1 |OPI1 |RTN1 |SEC63
Mutants/Phenotypes
Strains/Constructs
Teixeira MC, et al. (2009) Genome-wide identification of Saccharomyces cerevisiae genes required for maximal tolerance to ethanol. Appl Environ Microbiol 75(18):5761-72
       |AGP2 |ANP1 |ARC35 |BDP1 |BNA1 |CSL4 |CUP5 |CWC25 |ERG2 |ERG24 |FHL1 |FPS1 |GCN4 |GCR1 |MORE
Transcription
Yasokawa D, et al. (2009) Toxicity of Methanol and Formaldehyde Towards Saccharomyces cerevisiae as Assessed by DNA Microarray Analysis. Appl Biochem Biotechnol
       |AAD10 |AAD14 |AAD16 |AAD3 |AAD6 |ADH1 |ADH2 |ADH5 |ADH7 |AGP2 |ALD2 |ALD3 |ALD4 |ALD6 |MORE
Regulation of
Transcription
Ye Y, et al. (2009) Gaining insight into the response logic of Saccharomyces cerevisiae to heat shock by combining expression profiles with metabolic pathways. Biochem Biophys Res Commun 385(3):357-62
       |ADH6 |ADH7 |AFT1 |ARA1 |ATH1 |CRD1 |DPL1 |FHL1 |GCY1 |GDB1 |GLC3 |GLG1 |GLG2 |GPH1 |MORE
RNA Levels and Processing
Chang Q and Petrash JM (2008) Disruption of aldo-keto reductase genes leads to elevated markers of oxidative stress and inositol auxotrophy in Saccharomyces cerevisiae. Biochim Biophys Acta 1783(2):237-45
       |BCY1 |CDS1 |GCY1 |GRE3 |INO1 |YAP1 |YDL124W |YJR096W |YPR1
Regulation of
Transcription
Cheraiti N, et al. (2008) Acetaldehyde addition throughout the growth phase alleviates the phenotypic effect of zinc deficiency in Saccharomyces cerevisiae. Appl Microbiol Biotechnol 77(5):1093-1109
       |AAD14 |AAD15 |AAD16 |AAD3 |AAD4 |AAH1 |ACH1 |ADH1 |ADH4 |ALD3 |ALO1 |ARG3 |ARO1 |ASC1 |MORE
Genomic expression study
RNA Levels and Processing
Del Vescovo V, et al. (2008) Role of Hog1 and Yaf9 in the transcriptional response of Saccharomyces cerevisiae to cesium chloride. Physiol Genomics 33(1):110-20
       |AGA1 |ALD3 |ARO10 |ATG1 |BRL1 |CAR2 |CMK2 |COX5B |CPR1 |CPR7 |CWP1 |CYC7 |DAN4 |DDR48 |MORE
Strains/Constructs
Deng L, et al. (2008) Manipulation of major membrane lipid synthesis and its effects on sporulation in Saccharomyces cerevisiae. Biosci Biotechnol Biochem 72(9):2362-8
       |CHO2 |ERG7 |MUQ1 |PSD1 |PSD2
Genetic Interactions
Federovitch CM, et al. (2008) Genetic and structural analysis of Hmg2p-induced endoplasmic reticulum remodeling in Saccharomyces cerevisiae. Mol Biol Cell 19(10):4506-20
       |BNI1 |BNR1 |CHO2 |ERG28 |ERV25 |HER1 |HER2 |HMG1 |HMG2 |HOF1 |HRD1 |KAR2 |NEM1 |PSD1 |MORE
Cell Cycle Phase Involved
Mutants/Phenotypes
Strains/Constructs
Fong CS, et al. (2008) Oxidant-induced cell-cycle delay in Saccharomyces cerevisiae: the involvement of the SWI6 transcription factor. FEMS Yeast Res 8(3):386-99
         |ADE12 |ADE13 |ADE17 |ADE4 |ADE5,7 |ALD3 |ASF1 |BMH1 |BTN2 |CAX4 |COX15 |CPR6 |CWP1 |EOS1 |MORE
Genetic Interactions
Frederick RL, et al. (2008) Multiple pathways influence mitochondrial inheritance in budding yeast. Genetics 178(2):825-37
       |AAH1 |AEP1 |AIM11 |APP1 |ARO8 |ATP1 |ATP10 |ATP12 |ATP7 |BRE5 |CCE1 |CHO2 |COQ5 |COX19 |MORE
Mutants/Phenotypes
Strains/Constructs
Grossmann G, et al. (2008) Plasma membrane microdomains regulate turnover of transport proteins in yeast. J Cell Biol 183(6):1075-88
       |CAN1 |CAX4 |COG1 |ELP6 |ERG2 |ERG24 |ERG5 |ERG6 |FUR4 |FYV6 |GOS1 |HNT3 |MDG1 |MNN10 |MORE
Genetic Interactions
Mutants/Phenotypes
Han GS, et al. (2008) An unconventional diacylglycerol kinase that regulates phospholipid synthesis and nuclear membrane growth. J Biol Chem 283(29):20433-42
       |CDS1 |CHO2 |DGK1 |GAT2 |NEM1 |PAH1 |PSD1 |SPO7
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Krause SA, et al. (2008) The synthetic genetic network around PKC1 identifies novel modulators and components of protein kinase C signaling in Saccharomyces cerevisiae. Eukaryot Cell 7(11):1880-7
       |ACK1 |API2 |ATG15 |BCK1 |BNI1 |CHL1 |CIK1 |CSF1 |CTF19 |EGD1 |JNM1 |LAS21 |MID1 |MIG1 |MORE
Mutants/Phenotypes
Strains/Constructs
Malanovic N, et al. (2008) S-Adenosyl-L-homocysteine Hydrolase, Key Enzyme of Methylation Metabolism, Regulates Phosphatidylcholine Synthesis and Triacylglycerol Homeostasis in Yeast: IMPLICATIONS FOR HOMOCYSTEINE AS A RISK FACTOR OF ATHEROSCLEROSIS. J Biol Chem 283(35):23989-99
       |CHO2 |INO1 |OPI1 |SAH1
RNA Levels and Processing
Regulation of
Nunez LR, et al. (2008) Cell wall integrity MAPK pathway is essential for lipid homeostasis. J Biol Chem 283(49):34204-17
       |BCK1 |BGL2 |CCW14 |CHO2 |CHS6 |CHS7 |CKI1 |CRH1 |FLC2 |GFA1 |GIC2 |HSP150 |IME2 |INO1 |MORE
Alias
Cross-species Expression
Strains/Constructs
Reynolds JM, et al. (2008) Biochemical and Genetic Analysis of the Phosphoethanolamine Methyltransferase of the Human Malaria Parasite Plasmodium falciparum. J Biol Chem 283(12):7894-900
     |CHO2
Reviews
Sugimoto H, et al. (2008) Transcriptional regulation of phosphatidylcholine biosynthesis. Prog Lipid Res 47(3):204-20
       |CDS1 |CHO1 |CHO2 |CPT1 |EPT1 |INO1 |INO2 |INO4 |OPI1 |PSD1 |PSD2
Function/Process
Mutants/Phenotypes
Strains/Constructs
Tanaka K, et al. (2008) Incorporation and remodeling of extracellular phosphatidylcholine with short acyl residues in Saccharomyces cerevisiae. Biochim Biophys Acta 1781(8):391-9
       |ALE1 |CHO2 |PLB1 |PLB2 |PLB3
RNA Levels and Processing
Regulation of
Abe F (2007) Induction of DAN/TIR yeast cell wall mannoprotein genes in response to high hydrostatic pressure and low temperature. FEBS Lett 581(25):4993-8
         |AIM41 |COX17 |COX5B |CUP1-1 |CUP1-2 |CWP1 |CWP2 |CYC7 |DAN1 |DAN4 |ERG28 |GPG1 |GPH1 |GRX1 |MORE
Reviews
Carman GM and Han GS (2007) Regulation of phospholipid synthesis in Saccharomyces cerevisiae by zinc depletion. Biochim Biophys Acta 1771(3):322-30
       |CDS1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |DPP1 |EKI1 |EPT1 |INM1 |INO1 |OPI1 |PAH1 |PCT1 |MORE
Regulation of
Transcription
Feddersen S, et al. (2007) Transcriptional regulation of phospholipid biosynthesis is linked to fatty acid metabolism by an acyl-CoA-binding-protein-dependent mechanism in Saccharomyces cerevisiae. Biochem J 407(2):219-230
       |ACB1 |ACC1 |CHO1 |CHO2 |CTT1 |DDR2 |FAS1 |FAS2 |GPD1 |HNM1 |HSP12 |INO1 |ITR1 |OLE1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Harrison R, et al. (2007) Plasticity of genetic interactions in metabolic networks of yeast. Proc Natl Acad Sci U S A 104(7):2307-12
         |MUQ1 |PCT1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Loukin SH, et al. (2007) Lipid perturbations sensitize osmotic down-shock activated Ca2+ influx, a yeast "deletome" analysis. FASEB J 21(8):1813-20

Genetic Interactions
Strains/Constructs
Oki M, et al. (2007) Identification of novel suppressors for Mog1 implies its involvement in RNA metabolism, lipid metabolism and signal transduction. Gene 400(1-2):114-21
       |MOG1
Alias
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Riekhof WR, et al. (2007) Lysophosphatidylcholine metabolism in Saccharomyces cerevisiae: the role of P-type ATPases in transport and a broad specificity acyltransferase in acylation. J Biol Chem 282(51):36853-61
       |ALE1 |CHO2 |DNF1 |DNF2 |LEM3 |NTE1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Boumann HA, et al. (2006) Depletion of phosphatidylcholine in yeast induces shortening and increased saturation of the lipid acyl chains: evidence for regulation of intrinsic membrane curvature in a eukaryote. Mol Biol Cell 17(2):1006-17
       |CHO2 |OLE1 |SPO14
Reviews
Choi JY, et al. (2006) Macromolecular assemblies regulate nonvesicular phosphatidylserine traffic in yeast. Biochem Soc Trans 34(Pt 3):404-8
       |CHO1 |CHO2 |MET30 |MET4 |PSD1 |PSD2 |STT4
RNA Levels and Processing
Cullen PJ, et al. (2006) Genome-wide analysis of the response to protein glycosylation deficiency in yeast. FEMS Yeast Res 6(8):1264-73
     |ACS1 |ADR1 |ALD6 |AMS1 |CHS1 |CHS3 |CHS7 |CLB1 |CLB2 |CLN1 |CLN2 |CLN3 |CTT1 |DER1 |MORE
Function/Process
Mutants/Phenotypes
Hancock LC, et al. (2006) Genomic analysis of the Opi- phenotype. Genetics 173(2):621-34
       |AGE2 |ALG9 |APL5 |APL6 |APM3 |APS3 |ARC18 |BSD2 |CHO2 |CKB2 |DEP1 |DID4 |EAF1 |EAF3 |MORE
Reviews
Howe AG and McMaster CR (2006) Regulation of phosphatidylcholine homeostasis by Sec14. Can J Physiol Pharmacol 84(1):29-38
           |CHO2 |CKI1 |CPT1 |EPT1 |INO1 |NTE1 |OPI1 |PCT1 |PLB1 |SCS2 |SEC14 |SPO14
Regulation of
Transcription
Jesch SA, et al. (2006) Multiple endoplasmic reticulum-to-nucleus signaling pathways coordinate phospholipid metabolism with gene expression by distinct mechanisms. J Biol Chem 281(33):24070-83
       |ACC1 |CDS1 |CHO1 |CKI1 |CPT1 |FAA4 |FAS1 |FAS2 |HAC1 |INO1 |INO2 |ITR1 |KAR2 |MGA2 |MORE
RNA Levels and Processing
O'Hara L, et al. (2006) Control of phospholipid synthesis by phosphorylation of the yeast lipin Pah1p/Smp2p Mg2+-dependent phosphatidate phosphatase. J Biol Chem 281(45):34537-48
       |INO1 |NEM1 |OPI1 |PAH1 |SPO7
Cellular Location
Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
           |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Alias
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Gohil VM, et al. (2005) Synthetic lethal interaction of the mitochondrial phosphatidylethanolamine and cardiolipin biosynthetic pathways in Saccharomyces cerevisiae. J Biol Chem 280(42):35410-6
         |CHO2 |CRD1 |DPL1 |PSD1 |PSD2
RNA Levels and Processing
Iwahashi H, et al. (2005) Adaptation of Saccharomyces cerevisiae to high hydrostatic pressure causing growth inhibition. FEBS Lett 579(13):2847-52
           |AFR1 |CRG1 |GPG1 |HSP12 |INO1 |MET13 |MET6 |MOH1 |PIR3 |POX1 |PRM5 |PST1 |PTP2 |RTA1 |MORE
Cross-species Expression
Function/Process
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Pessi G, et al. (2005) In vivo evidence for the specificity of Plasmodium falciparum phosphoethanolamine methyltransferase and its coupling to the Kennedy pathway. J Biol Chem 280(13):12461-6
       |CHO2 |PCT1
Function/Process
Mutants/Phenotypes
Protein Physical Properties
Strains/Constructs
Substrates/Ligands/Cofactors
Boumann HA, et al. (2004) The yeast phospholipid N-methyltransferases catalyzing the synthesis of phosphatidylcholine preferentially convert di-C16:1 substrates both in vivo and in vitro. J Biol Chem 279(39):40314-9
       |CHO2
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Choi JY, et al. (2004) Phosphatidylcholine and N-methylated phospholipids are nonessential in Saccharomyces cerevisiae. J Biol Chem 279(40):42321-30
       |CHO2
Genetic Interactions
Strains/Constructs
Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9
           |ARV1 |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |BUD25 |CAX4 |CHO2 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |MORE
Genomic expression study
RNA Levels and Processing
Regulation of
Parveen M, et al. (2004) Response of Saccharomyces cerevisiae to a monoterpene: evaluation of antifungal potential by DNA microarray analysis. J Antimicrob Chemother 54(1):46-55
               |AAD6 |ADH5 |ADH7 |ADY2 |AGA2 |AMS1 |ARG1 |ARN2 |ATF2 |ATX1 |BCK1 |BFR1 |BSC1 |BUD7 |MORE
Mutants/Phenotypes
Strains/Constructs
Roggero R, et al. (2004) Unraveling the mode of action of the antimalarial choline analog G25 in Plasmodium falciparum and Saccharomyces cerevisiae. Antimicrob Agents Chemother 48(8):2816-24
       |CHO2 |CKI1 |CPT1 |EKI1 |EPT1 |HNM1 |MUQ1 |PCT1 |PSD1 |PSD2
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
DNA/RNA Sequence Features
RNA Levels and Processing
Regulation of
Aburatani S, et al. (2003) Discovery of novel transcription control relationships with gene regulatory networks generated from multiple-disruption full genome expression libraries. DNA Res 10(1):1-8
         |ACO1 |ACS1 |AGA1 |ARG3 |ARG4 |CAR1 |CAR2 |CPA2 |CRC1 |DAL1 |DMC1 |FRE1 |HEM3 |HOP1 |MORE
Regulation of
Ding D and Greenberg ML (2003) Lithium and valproate decrease the membrane phosphatidylinositol/phosphatidylcholine ratio. Mol Microbiol 47(2):373-81
         |CHO1 |INO1 |INO2
RNA Levels and Processing
Regulation of
Transcription
Murata Y, et al. (2003) Dimethyl sulfoxide exposure facilitates phospholipid biosynthesis and cellular membrane proliferation in yeast cells. J Biol Chem 278(35):33185-93
         |INO1
Regulation of
Transcription
Santiago TC and Mamoun CB (2003) Genome expression analysis in yeast reveals novel transcriptional regulation by inositol and choline and new regulatory functions for Opi1p, Ino2p, and Ino4p. J Biol Chem 278(40):38723-30
       |AAD10 |ACH1 |AMS1 |ANB1 |BIO2 |BIO3 |BIO4 |BIO5 |CIT3 |CRC1 |CWP1 |DAN1 |DUR3 |ECM13 |MORE
Cellular Location
Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
         |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
Mutants/Phenotypes
Willingham S, et al. (2003) Yeast genes that enhance the toxicity of a mutant huntingtin fragment or alpha-synuclein. Science 302(5651):1769-72
           |ABZ2 |AIM46 |ALB1 |APE2 |APJ1 |APM2 |ARL3 |ARO1 |ATG15 |AYR1 |CIT2 |CMK1 |COG6 |COS111 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Bidlingmaier S and Snyder M (2002) Large-scale identification of genes important for apical growth in Saccharomyces cerevisiae by directed allele replacement technology (DART) screening. Funct Integr Genomics 1(6):345-56
       |API2 |CBK1 |CDC34 |COG5 |ECM33 |FAB1 |PAN1 |RAS2 |SEC22 |SLA1 |SLA2 |SMY1 |SPA2 |VID22 |MORE
Genetic Interactions
Strains/Constructs
Huang D, et al. (2002) Dissection of a complex phenotype by functional genomics reveals roles for the yeast cyclin-dependent protein kinase Pho85 in stress adaptation and cell integrity. Mol Cell Biol 22(14):5076-88
           |ANP1 |BCK1 |BEM1 |BEM2 |BEM4 |BNI1 |BRE1 |CHO2 |CLA4 |CLG1 |EFR3 |ERD1 |FKS1 |FKS3 |MORE
Function/Process
Mutants/Phenotypes
Protein Physical Properties
Strains/Constructs
Janssen MJ, et al. (2002) Cooperative activity of phospholipid-N-methyltransferases localized in different membranes. FEBS Lett 513(2-3):197-202
       |CHO2
RNA Levels and Processing
Regulation of
Angus-Hill ML, et al. (2001) A Rsc3/Rsc30 zinc cluster dimer reveals novel roles for the chromatin remodeler RSC in gene expression and cell cycle control. Mol Cell 7(4):741-51
           |CWP1 |GLC7 |PAF1 |PKC1 |RSC3 |RSC30 |SCW11
Function/Process
Mutants/Phenotypes
Strains/Constructs
Dowd SR, et al. (2001) Turnover of phosphatidylcholine in Saccharomyces cerevisiae. The role of the CDP-choline pathway. J Biol Chem 276(6):3756-63
       |CHO2 |CKI1 |CPT1 |PCT1
Reviews
McMaster CR (2001) Lipid metabolism and vesicle trafficking: more than just greasing the transport machinery. Biochem Cell Biol 79(6):681-92
       |CHO2 |CKI1 |CPT1 |FAB1 |HNM1 |INO2 |INO4 |KES1 |MSS4 |PCT1 |PIK1 |SAC1 |SEC14 |SIT4 |MORE
Protein Sequence Features
Romano JD and Michaelis S (2001) Topological and mutational analysis of Saccharomyces cerevisiae Ste14p, founding member of the isoprenylcysteine carboxyl methyltransferase family. Mol Biol Cell 12(7):1957-71
       |CHO2 |ERG24 |ERG4 |STE14
Non-Fungal Related Genes/Proteins
Bolognese CP and McGraw P (2000) The isolation and characterization in yeast of a gene for Arabidopsis S-adenosylmethionine:phospho-ethanolamine N-methyltransferase. Plant Physiol 124(4):1800-13
       |CHO2 |DIM1
Regulation of
Elkhaimi M, et al. (2000) Combinatorial regulation of phospholipid biosynthetic gene expression by the UME6, SIN3 and RPD3 genes. Nucleic Acids Res 28(16):3160-7
       |CHO1 |CHO2 |INO1 |INO2 |RPD3 |SIN3 |UME6
Function/Process
Substrates/Ligands/Cofactors
Janssen MJ, et al. (2000) The phosphatidylcholine to phosphatidylethanolamine ratio of Saccharomyces cerevisiae varies with the growth phase. Yeast 16(7):641-50
       |CHO1 |CHO2 |INO1
Reviews
Kent C and Carman GM (1999) Interactions among pathways for phosphatidylcholine metabolism, CTP synthesis and secretion through the Golgi apparatus. Trends Biochem Sci 24(4):146-50
       |CHO2 |SEC14
Reviews
Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510
       |ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Fungal Related Genes/Proteins
Kanipes MI, et al. (1998) The Schizosaccharomyces pombe cho1+ gene encodes a phospholipid methyltransferase. Genetics 150(2):553-62

RNA Levels and Processing
Cox JS, et al. (1997) The unfolded protein response coordinates the production of endoplasmic reticulum protein and endoplasmic reticulum membrane. Mol Biol Cell 8(9):1805-14
     |HAC1 |HMG1 |INO1 |IRE1 |KAR2 |OPI1
Regulation of
Transcription
Wodicka L, et al. (1997) Genome-wide expression monitoring in Saccharomyces cerevisiae. Nat Biotechnol 15(13):1359-67
     |GIT1 |HSP26 |INO1
Regulation of
Transcription
Griac P, et al. (1996) The role of phosphatidylcholine biosynthesis in the regulation of the INO1 gene of yeast. J Biol Chem 271(41):25692-8
       |CHO2 |CPT1 |EPT1 |INO1
Alias
DNA/RNA Sequence Features
Mapping
Huang ME, et al. (1996) Analysis of a 62 kb DNA sequence of chromosome X reveals 36 open reading frames and a gene cluster with a counterpart on chromosome XI. Yeast 12(9):869-75
     |AIM24 |APS2 |ARP3 |BNA2 |CBF1 |CCT5 |CDC11 |CDC8 |EMC2 |ERM6 |FIP1 |GRR1 |HIT1 |HOC1 |MORE
Regulation of
Transcription
Jackson JC and Lopes JM (1996) The yeast UME6 gene is required for both negative and positive transcriptional regulation of phospholipid biosynthetic gene expression. Nucleic Acids Res 24(7):1322-9
       |CHO1 |CHO2 |INO1 |INO2 |OPI1 |UME6
Mapping
Anderson MS, et al. (1995) Physical map locations of the phospholipid biosynthetic structural and regulatory genes of Saccharomyces cerevisiae. Yeast 11(2):187-90
     |CHO2 |INO1 |PIS1 |UME6
Alias
Regulation of
Transcription
Kodaki T, et al. (1995) The SNF2/SWI2/GAM1/TYE3/RIC1 gene is involved in the coordinate regulation of phospholipid synthesis in Saccharomyces cerevisiae. J Biochem 117(2):362-8
     |CHO2 |INO1 |SNF2
Alias
Regulation of
Transcription
Hosaka K, et al. (1994) Cloning and characterization of the SCS1 gene required for the expression of genes in yeast phospholipid synthesis. J Biochem 115(1):131-6
     |CHO2 |INO1 |INO2 |SCS2
Regulation of
Transcription
Hudak KA, et al. (1994) A pleiotropic phospholipid biosynthetic regulatory mutation in Saccharomyces cerevisiae is allelic to sin3 (sdi1, ume4, rpd1). Genetics 136(2):475-83
     |CHO1 |CHO2 |INO1 |SIN3
Regulation of
Transcription
Lamping E, et al. (1994) Isolation and characterization of a mutant of Saccharomyces cerevisiae with pleiotropic deficiencies in transcriptional activation and repression. Genetics 137(1):55-65
     |CHO1 |DEP1 |INO1 |PHO5 |RPD3 |SIN3 |SPT10 |SPT21
Alias
Non-Fungal Related Genes/Proteins
Cui Z, et al. (1993) Cloning and expression of a novel phosphatidylethanolamine N-methyltransferase. A specific biochemical and cytological marker for a unique membrane fraction in rat liver. J Biol Chem 268(22):16655-63

Mutants/Phenotypes
Other Features
Techniques and Reagents
Greenberg ML and Axelrod D (1993) Anomalously slow mobility of fluorescent lipid probes in the plasma membrane of the yeast Saccharomyces cerevisiae. J Membr Biol 131(2):115-27
     |INO1
DNA/RNA Sequence Features
Genetic Interactions
Mutants/Phenotypes
Regulation of
Strains/Constructs
Preitschopf W, et al. (1993) Molecular cloning of the yeast OPI3 gene as a high copy number suppressor of the cho2 mutation. Curr Genet 23(2):95-101
     |CDS1 |CHO2 |INO1
Reviews
Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   |ACC1 |ACH1 |CDS1 |CHO1 |CHO2 |CKI1 |CTR1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |MORE
Mutants/Phenotypes
Regulation of
Transcription
Gaynor PM, et al. (1991) Regulation of phosphatidylethanolamine methyltransferase and phospholipid methyltransferase by phospholipid precursors in Saccharomyces cerevisiae. Biochim Biophys Acta 1090(3):326-32
     |CHO2
Alias
DNA/RNA Sequence Features
Protein-Nucleic Acid Interactions
RNA Levels and Processing
Regulation of
Transcription
Kodaki T, et al. (1991) Identification of the upstream activation sequences responsible for the expression and regulation of the PEM1 and PEM2 genes encoding the enzymes of the phosphatidylethanolamine methylation pathway in Saccharomyces cerevisiae. J Biochem 109(2):276-87
     |CHO2
Regulation of
Overmeyer JH and Waechter CJ (1991) Regulation of phosphatidylserine decarboxylase in Saccharomyces cerevisiae by inositol and choline: kinetics of repression and derepression. Arch Biochem Biophys 290(2):511-6
     |PSD1
Function/Process
Mutants/Phenotypes
Other Features
Strains/Constructs
Substrates/Ligands/Cofactors
Gaynor PM and Carman GM (1990) Phosphatidylethanolamine methyltransferase and phospholipid methyltransferase activities from Saccharomyces cerevisiae. Enzymological and kinetic properties. Biochim Biophys Acta 1045(2):156-63
     |CHO2
Alias
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Kodaki T and Yamashita S (1989) Characterization of the methyltransferases in the yeast phosphatidylethanolamine methylation pathway by selective gene disruption. Eur J Biochem 185(2):243-51
     |CHO2
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
McGraw P and Henry SA (1989) Mutations in the Saccharomyces cerevisiae opi3 gene: effects on phospholipid methylation, growth and cross-pathway regulation of inositol synthesis. Genetics 122(2):317-30
     |CHO2 |INO1
Mutants/Phenotypes
Regulatory Role
Greenberg ML, et al. (1988) Inositol regulates phosphatidylglycerolphosphate synthase expression in Saccharomyces cerevisiae. Mol Cell Biol 8(11):4773-9
     |CHO2 |OPI1
Alias
DNA/RNA Sequence Features
Function/Process
Fungal Related Genes/Proteins
Protein Sequence Features
RNA Levels and Processing
Strains/Constructs
Kodaki T and Yamashita S (1987) Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes. J Biol Chem 262(32):15428-35
     |CHO2
Mapping
Mutants/Phenotypes
Strains/Constructs
Greenberg ML, et al. (1983) Yeast mutant defective in phosphatidylcholine synthesis. J Bacteriol 153(2):791-9
     |INO4
Mutants/Phenotypes
Strains/Constructs
Greenberg ML, et al. (1982) Regulatory mutations of inositol biosynthesis in yeast: isolation of inositol-excreting mutants. Genetics 100(1):19-33
     |INO1 |OPI1
Alias
Function/Process
Mutants/Phenotypes
Regulation of
Strains/Constructs
Yamashita S, et al. (1982) Regulation of the phosphatidylethanolamine methylation pathway in Saccharomyces cerevisiae. Eur J Biochem 128(2-3):589-95
     |CHO2

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.