---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

SOP4/YJL192C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrX: 73413 to 72709 CDS: 73413 - 72709 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
SOP4	YJL192C		ORF, Verified	S000003728
Description
ER-membrane protein; suppressor of pma1-7, deletion of SOP4 slows down the export of wild-type Pma1p and Pma1-7 from the ER

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2003-03-21 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By ER to Golgi vesicle-mediated transport Luo WJ, et al. (2002) An ER membrane protein, Sop4, facilitates ER export of the yeast plasma membrane [H+]ATPase, Pma1. Traffic 3(10):730-9            IMP : Inferred from Mutant Phenotype Assigned on 2003-03-21 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2008-04-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2008-04-01 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Luo WJ, et al. (2002) An ER membrane protein, Sop4, facilitates ER export of the yeast plasma membrane [H+]ATPase, Pma1. Traffic 3(10):730-9            IDA : Inferred from Direct Assay Assigned on 2003-03-21 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2008-04-01 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9905 Assigned on 2009-10-01 UniProtKB integral to membrane of membrane fraction Luo WJ, et al. (2002) An ER membrane protein, Sop4, facilitates ER export of the yeast plasma membrane [H+]ATPase, Pma1. Traffic 3(10):730-9            IDA : Inferred from Direct Assay Assigned on 2003-03-21 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-04-01 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forSOP4/YJL192C for SOP4 1) Luo W and Chang A (1997) Novel genes involved in endosomal traffic in yeast revealed by suppression of a targeting-defective plasma membrane ATPase mutant. J Cell Biol 138(4):731-46        2) Luo WJ, et al. (2002) An ER membrane protein, Sop4, facilitates ER export of the yeast plasma membrane [H+]ATPase, Pma1. Traffic 3(10):730-9

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SOP4/YJL192C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SOP4/YJL192C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MFSQIVL C-term YAAVASK Length(aa) 234 MW(Da) 26,597 pI 10.31 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.135   Codon Adaptation Index 0.160   Frequency of Optimal Codons 0.487   Hydropathicity of Protein -0.101   Aromaticity Score 0.124	10 20 30 40 50 | | | | | MFSQIVLLLSAFIYVASATARRGTIKGRLDLAASNITGFVSTRTSFKLYQ IGNFSTEYPYTSTTMFQDDEGNFEFANLPLNDGVNETTYYVMYPASMDFN LKPNRILIEFKNLENGTLQLNAFKNFFGREYFPSKDITYPEKLQSMKVHP YITVELLHKAPIRSYLQARNVSIFSTGIVGNILNSRWKLAGVITLIALVV FPIIVEKLDPETARAIREEAKRKQREKYAAVASK*

Protein Structures from PDB: proteins of known structure with sequence similarity to SOP4/YJL192C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
SOP4	Luo W and Chang A (1997) Novel genes involved in endosomal traffic in yeast revealed by suppression of a targeting-defective plasma membrane ATPase mutant. J Cell Biol 138(4):731-46

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YJL192C	SGD Systematic Sequence
853247	NCBI: Gene ID
NP_012343.1	NCBI: RefSeq protein version ID
NP_012343.1	NCBI: RefSeq protein version ID
6322269	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
5 curated references; 0 references not yet curated
Reviews	Toulmay A and Schneiter R (2007) Lipid-dependent surface transport of the proton pumping ATPase: A model to study plasma membrane biogenesis in yeast. Biochimie 89(2):249-54	|AST1 |AUR1 |BUL1 |BUL2 |PMA1 |RSP5 |SFB3 |SUR4
Function/Process Mutants/Phenotypes Strains/Constructs	Deutschbauer AM, et al. (2002) Parallel phenotypic analysis of sporulation and postgermination growth in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 99(24):15530-5	|ALG3 |ECM18 |EMI5 |IRC19 |MRPS16 |MUM3 |PMA2 |SMA2 |YAP3 |YBL083C |YBR027C |YJR120W
Alias Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Physical Properties Protein Processing/Modification/Regulation Protein Sequence Features Regulation of Strains/Constructs	Luo WJ, et al. (2002) An ER membrane protein, Sop4, facilitates ER export of the yeast plasma membrane [H+]ATPase, Pma1. Traffic 3(10):730-9	|GAS1 |PMA1 |PRC1 |SEC13 |SEC14 |STE2
Alias Mutants/Phenotypes Strains/Constructs	Luo W and Chang A (1997) Novel genes involved in endosomal traffic in yeast revealed by suppression of a targeting-defective plasma membrane ATPase mutant. J Cell Biol 138(4):731-46	|BSD2 |INP51 |INP52 |INP53 |KEX2 |MVP1 |PEP1 |PMA1 |VPS13 |VPS27 |VPS29 |VPS35 |VPS36 |VPS38 |MORE
DNA/RNA Sequence Features	Purnelle B, et al. (1994) The sequence of a 36 kb segment on the left arm of yeast chromosome X identifies 24 open reading frames including NUC1, PRP21 (SPP91), CDC6, CRY2, the gene for S24, a homologue to the aconitase gene ACO1 and two homologues to chromosome III genes. Yeast 10(9):1235-49	|ACO1 |CDC6 |NUC1 |PRP21 |PUT3 |RPS14B |SLY41 |UBC6 |YJL193W |YJL195C |YJL206C |YPT1

Return to SGD

Send a Message to the SGD Curators