---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

LCB3/YJL134W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrX: 158184 to 159413 CDS: 158184 - 159413 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
LCB3	YJL134W	LBP1, YSR2	ORF, Verified	S000003670
Description
Long-chain base-1-phosphate phosphatase with specificity for dihydrosphingosine-1-phosphate, regulates ceramide and long-chain base phosphates levels, involved in incorporation of exogenous long chain bases in sphingolipids

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By catalytic activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000326 Assigned on 2008-02-13 UniProtKB hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2009-01-12 UniProtKB sphingosine-1-phosphate phosphatase activity Mao C, et al. (1997) Identification and characterization of Saccharomyces cerevisiae dihydrosphingosine-1-phosphate phosphatase. J Biol Chem 272(45):28690-4        IDA : Inferred from Direct Assay Assigned on 2003-03-12 SGD Birchwood CJ, et al. (2001) Calcium influx and signaling in yeast stimulated by intracellular sphingosine 1-phosphate accumulation. J Biol Chem 276(15):11712-8        TAS : Traceable Author Statement Assigned on 2002-08-30 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By calcium-mediated signaling Birchwood CJ, et al. (2001) Calcium influx and signaling in yeast stimulated by intracellular sphingosine 1-phosphate accumulation. J Biol Chem 276(15):11712-8        IMP : Inferred from Mutant Phenotype Assigned on 2002-09-25 SGD lipid metabolic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0443 Assigned on 2009-10-01 UniProtKB sphingolipid biosynthetic process Mao C and Obeid LM (2000) Yeast sphingosine-1-phosphate phosphatases: assay, expression, deletion, purification, and cellular localization by GFP tagging. Methods Enzymol 311:223-32      TAS : Traceable Author Statement Assigned on 2002-08-21 SGD sphingolipid metabolic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0746 Assigned on 2009-01-12 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Mao C, et al. (1999) The dihydrosphingosine-1-phosphate phosphatases of Saccharomyces cerevisiae are important regulators of cell proliferation and heat stress responses. Biochem J 342 Pt 3():667-75        IDA : Inferred from Direct Assay Assigned on 2002-09-25 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000326 Assigned on 2008-02-13 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
sphingolipid metabolism

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for LCB3/YJL134W for LCB3 About sphingolipid metabolism Sphingolipids are essential components of the plasma membrane in all eukaryotic cells. S. cerevisiae cells make three complex sphingolipids: inositol-phosphoceramide (IPC), mannose-inositol-phosphoceramide (MIPC), and mannose-(inositol phosphate)2-ceramide (M(IP)2C)(1). In the yeast plasma membrane sphingolipids concentrate with ergosterol to form lipid rafts, specialized membrane microdomains implicated in a variety of cellular processes, including sorting of membrane proteins and lipids, as well as organizing and regulating signaling cascades (2). Intermediates in sphingolipid biosynthesis have been shown to play important roles as signaling molecules and growth regulators. Sphingolipid long chain bases (LCBs), dihydrosphingosine (DHS) and phytosphingosine (PHS), have been implicated as secondary messengers in signaling pathways that regulate heat stress response (3, 4). Other intermediates, phytoceramide and long-chain base phosphates (LCBPs), have been shown to be components of the tightly-controlled ceramide/LCBP rheostat, which regulates cell growth (5). Since phosphoinositol-containing sphingolipids are unique to fungi, the sphingolipid biosynthesis pathway is considered a target for antifungal drugs (6, 7). Last Updated: 2007-10-05

Basic References [TOP]

BASIC INFORMATION REFERENCES forLCB3/YJL134W for LCB3 1) Dickson RC and Lester RL (2002) Sphingolipid functions in Saccharomyces cerevisiae. Biochim Biophys Acta 1583(1):13-25            2) Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80        3) Jenkins GM, et al. (1997) Involvement of yeast sphingolipids in the heat stress response of Saccharomyces cerevisiae. J Biol Chem 272(51):32566-72        4) Ferguson-Yankey SR, et al. (2002) Mutant analysis reveals complex regulation of sphingolipid long chain base phosphates and long chain bases during heat stress in yeast. Yeast 19(7):573-86      5) Kobayashi SD and Nagiec MM (2003) Ceramide/long-chain base phosphate rheostat in Saccharomyces cerevisiae: regulation of ceramide synthesis by Elo3p and Cka2p. Eukaryot Cell 2(2):284-94        6) Nagiec MM, et al. (1997) Sphingolipid synthesis as a target for antifungal drugs. Complementation of the inositol phosphorylceramide synthase defect in a mutant strain of Saccharomyces cerevisiae by the AUR1 gene. J Biol Chem 272(15):9809-17        7) Sugimoto Y, et al. (2004) IPC synthase as a useful target for antifungal drugs. Curr Drug Targets Infect Disord 4(4):311-22        8) Mao C, et al. (1997) Identification and characterization of Saccharomyces cerevisiae dihydrosphingosine-1-phosphate phosphatase. J Biol Chem 272(45):28690-4        9) Mandala SM, et al. (1998) Sphingoid base 1-phosphate phosphatase: a key regulator of sphingolipid metabolism and stress response. Proc Natl Acad Sci U S A 95(1):150-5        10) Qie L, et al. (1997) Identification of a Saccharomyces gene, LCB3, necessary for incorporation of exogenous long chain bases into sphingolipids. J Biol Chem 272(26):16110-7        11) Kihara A, et al. (2003) Transmembrane topology of sphingoid long-chain base-1-phosphate phosphatase, Lcb3p. Genes Cells 8(6):525-35

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for LCB3/YJL134W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for LCB3/YJL134W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MVDGLNT C-term FSLLNIA Length(aa) 409 MW(Da) 47,371 pI 9.33 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.028   Codon Adaptation Index 0.113   Frequency of Optimal Codons 0.412   Hydropathicity of Protein 0.200   Aromaticity Score 0.154

10 20 30 40 50 | | | | | MVDGLNTSNIRKRARTLSNPNDFQEPNYLLDPGNHPSDHFRTRMSKFRFN IREKLLVFTNNQSFTLSRWQKKYRSAFNDLYFTYTSLMGSHTFYVLCLPM PVWFGYFETTKDMVYILGYSIYLSGFFKDYWCLPRPRAPPLHRITLSEYT TKEYGAPSSHTANATGVSLLFLYNIWRMQESSVMVQLLLSCVVLFYYMTL VFGRIYCGMHGILDLVSGGLIGIVCFIVRMYFKYRFPGLRIEEHWWFPLF SVGWGLLLLFKHVKPVDECPCFQDSVAFMGVVSGIECCDWLGKVFGVTLV YNLEPNCGWRLTLARLLVGLPCVVIWKYVISKPMIYTLLIKVFHLKDDRN VAARKRLEATHKEGASKYECPLYIGEPKIDILGRFIIYAGVPFTVVMCSP VLFSLLNIA*

Protein Structures from PDB: proteins of known structure with sequence similarity to LCB3/YJL134W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
LCB3	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YJL134W	SGD Systematic Sequence
853307	NCBI: Gene ID
NP_012401.1	NCBI: RefSeq protein version ID
NP_012401.1	NCBI: RefSeq protein version ID
6322327	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
35 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes Strains/Constructs	DeLuna A, et al. (2008) Exposing the fitness contribution of duplicated genes. Nat Genet 40(5):676-81	|GDH1 |GDH3 |ITR1 |ITR2 |NDE1 |NDE2 |YSR3
Reviews	Dickson RC (2008) Thematic Review Series: Sphingolipids. New insights into sphingolipid metabolism and function in budding yeast. J Lipid Res 49(5):909-21	|AUR1 |CSG2 |CSH1 |DPL1 |FEN1 |IFA38 |IPT1 |ISC1 |LCB1 |LCB2 |LCB4 |LCB5 |LIP1 |PHS1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Brace JL, et al. (2007) SVF1 regulates cell survival by affecting sphingolipid metabolism in Saccharomyces cerevisiae. Genetics 175(1):65-76	|DPL1 |LCB4 |SUR2 |SVF1 |YPK1
Reviews	Cowart LA and Obeid LM (2007) Yeast sphingolipids: recent developments in understanding biosynthesis, regulation, and function. Biochim Biophys Acta 1771(3):421-31	|AUR1 |CSG2 |CSH1 |DPL1 |FEN1 |ISC1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB4 |LCB5 |SUR1 |SUR4 |MORE
Reviews	Kihara A, et al. (2007) Metabolism and biological functions of two phosphorylated sphingolipids, sphingosine 1-phosphate and ceramide 1-phosphate. Prog Lipid Res 46(2):126-44	|DPL1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB4 |LCB5 |LIP1 |SUR2 |TSC10 |TSC3 |YDC1 |YPC1 |YSR3
Non-Fungal Related Genes/Proteins	Le Stunff H, et al. (2007) Recycling of Sphingosine Is Regulated by the Concerted Actions of Sphingosine-1-phosphate Phosphohydrolase 1 and Sphingosine Kinase 2. J Biol Chem 282(47):34372-80
Reviews	Dickson RC, et al. (2006) Functions and metabolism of sphingolipids in Saccharomyces cerevisiae. Prog Lipid Res 45(6):447-65	|ARV1 |AUR1 |CSH1 |DPL1 |FEN1 |IPT1 |LCB1 |LCB2 |LCB4 |LCB5 |NCR1 |PKH1 |PKH2 |SCS7 |MORE
Reviews	Riezman H (2006) Organization and functions of sphingolipid biosynthesis in yeast. Biochem Soc Trans 34(3):367-369	|AUR1 |CSG2 |DPL1 |IPT1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB4 |LCB5 |LIP1 |SUR1 |SUR2 |TSC3 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22	|ACB1 |ACC1 |ARE1 |ARE2 |AYR1 |CSG2 |DPL1 |ELO1 |ERG24 |ERG3 |ERG4 |ERG5 |FEN1 |HEM1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Sano T, et al. (2005) Regulation of the sphingoid long-chain base kinase Lcb4p by ergosterol and heme: studies in phytosphingosine-resistant mutants. J Biol Chem 280(44):36674-82	|DPL1 |ERG2 |ERG3 |ERG4 |ERG5 |ERG6 |HAP1 |HEM14 |HMG1 |KES1 |LCB4 |PBP1 |PDR5 |TPS1 |MORE
Non-Fungal Related Genes/Proteins Reviews	Saba JD and Hla T (2004) Point-counterpoint of sphingosine 1-phosphate metabolism. Circ Res 94(6):724-34	|LCB4 |LCB5 |YSR3
Function/Process	Funato K, et al. (2003) Lcb4p is a key regulator of ceramide synthesis from exogenous long chain sphingoid base in Saccharomyces cerevisiae. J Biol Chem 278(9):7325-34	|LCB4 |LCB5
Cellular Location Function/Process Protein Sequence Features Substrates/Ligands/Cofactors	Kihara A, et al. (2003) Transmembrane topology of sphingoid long-chain base-1-phosphate phosphatase, Lcb3p. Genes Cells 8(6):525-35	|DPP1 |LPP1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kobayashi SD and Nagiec MM (2003) Ceramide/long-chain base phosphate rheostat in Saccharomyces cerevisiae: regulation of ceramide synthesis by Elo3p and Cka2p. Eukaryot Cell 2(2):284-94	|CKA2 |SUR4
Function/Process Mutants/Phenotypes Strains/Constructs	Bagnat M and Simons K (2002) Cell surface polarization during yeast mating. Proc Natl Acad Sci U S A 99(22):14183-8	|BUL1 |BUL2 |ERG6 |FIG1 |FUS1 |FUS2 |GAP1 |HXT2 |LCB1 |PRM1 |SHO1 |STE6 |TRE1
Reviews	Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80	|AUR1 |CSG2 |IPT1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB4 |LCB5 |SUR1 |SUR2 |TSC10 |YSR3
Function/Process	Ferguson-Yankey SR, et al. (2002) Mutant analysis reveals complex regulation of sphingolipid long chain base phosphates and long chain bases during heat stress in yeast. Yeast 19(7):573-86	|DPL1 |LCB4 |LCB5
Reviews	Funato K, et al. (2002) Biosynthesis and trafficking of sphingolipids in the yeast Saccharomyces cerevisiae. Biochemistry 41(51):15105-14	|ACB1 |AUR1 |CCC2 |CSG2 |DPL1 |ELO1 |FEN1 |FMP45 |IFA38 |IPT1 |ISC1 |LAC1 |LAG1 |LCB1 |MORE
Alias Function/Process Genetic Interactions	Swain E, et al. (2002) Sterol-dependent regulation of sphingolipid metabolism in Saccharomyces cerevisiae. J Biol Chem 277(29):26177-84	|CCC2 |ERG26 |SCS7 |SUR2
Function/Process Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs	Birchwood CJ, et al. (2001) Calcium influx and signaling in yeast stimulated by intracellular sphingosine 1-phosphate accumulation. J Biol Chem 276(15):11712-8	|CCH1 |DPL1 |LCB4 |LCB5 |MID1
Function/Process Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs Substrates/Ligands/Cofactors	Zhang X, et al. (2001) Elevation of endogenous sphingolipid long-chain base phosphates kills Saccharomyces cerevisiae cells. Curr Genet 40(4):221-33	|DPL1 |LCB4 |LCB5
Function/Process Mutants/Phenotypes Strains/Constructs	de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42	|AAD4 |AIM22 |ALG12 |ALK2 |ARE2 |ARG2 |ARP5 |ASI2 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Kim S, et al. (2000) Accumulation of phosphorylated sphingoid long chain bases results in cell growth inhibition in Saccharomyces cerevisiae. Genetics 156(4):1519-29	|DPL1 |LCB4 |LCB5 |SUR2 |YSR3
Alias Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Mandala SM, et al. (2000) Molecular cloning and characterization of a lipid phosphohydrolase that degrades sphingosine-1- phosphate and induces cell death. Proc Natl Acad Sci U S A 97(14):7859-64	|YSR3
Alias Function/Process Substrates/Ligands/Cofactors Techniques and Reagents	Mao C and Obeid LM (2000) Yeast sphingosine-1-phosphate phosphatases: assay, expression, deletion, purification, and cellular localization by GFP tagging. Methods Enzymol 311:223-32	|YSR3
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Zanolari B, et al. (2000) Sphingoid base synthesis requirement for endocytosis in Saccharomyces cerevisiae. EMBO J 19(12):2824-33	|ACT1 |LCB1 |LCB4 |LCB5 |SLA2 |YSR3
Alias Function/Process Mutants/Phenotypes Strains/Constructs	Dickson RC and Lester RL (1999) Metabolism and selected functions of sphingolipids in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1438(3):305-21	|AUR1 |CSG2 |DPL1 |ERG2 |FAS2 |FEN1 |IPT1 |LCB1 |LCB2 |LCB4 |LCB5 |MSN2 |MSN4 |MSS4 |MORE
Alias Cell Cycle Phase Involved Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Mao C, et al. (1999) The dihydrosphingosine-1-phosphate phosphatases of Saccharomyces cerevisiae are important regulators of cell proliferation and heat stress responses. Biochem J 342 Pt 3():667-75	|YSR3
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Skrzypek MS, et al. (1999) Analysis of phosphorylated sphingolipid long-chain bases reveals potential roles in heat stress and growth control in Saccharomyces. J Bacteriol 181(4):1134-40	|DPL1
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Reviews	Dickson RC (1998) Sphingolipid functions in Saccharomyces cerevisiae: comparison to mammals. Annu Rev Biochem 67:27-48	|CSG2 |DPL1 |IPT1 |LCB1 |LCB2 |SAC1 |SUR2
Alias Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Mandala SM, et al. (1998) Sphingoid base 1-phosphate phosphatase: a key regulator of sphingolipid metabolism and stress response. Proc Natl Acad Sci U S A 95(1):150-5	|YSR3
Alias Function/Process Mutants/Phenotypes Strains/Constructs	Mao C, et al. (1997) Identification and characterization of Saccharomyces cerevisiae dihydrosphingosine-1-phosphate phosphatase. J Biol Chem 272(45):28690-4	|YSR3
DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs Techniques and Reagents	Qie L, et al. (1997) Identification of a Saccharomyces gene, LCB3, necessary for incorporation of exogenous long chain bases into sphingolipids. J Biol Chem 272(26):16110-7	|YSR3
DNA/RNA Sequence Features Mapping Strains/Constructs	Katsoulou C, et al. (1996) Sequence analysis of a 40.7 kb segment from the left arm of yeast chromosome X reveals 14 known genes and 13 new open reading frames including homologues of genes clustered on the right arm of chromosome XI. Yeast 12(8):787-97	|INO1 |MRS3 |RPA34 |RPB4 |SNA3 |SNR128 |SNR190 |TIF2 |TIM17 |URA2 |VPS35 |YAK1 |YJL135W |YJL144W |MORE

Return to SGD

Send a Message to the SGD Curators