PHO86/YJL117W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrX: 192529 to 193464
CDS: 192529 - 193464

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

PHO86 YJL117W ORF, Verified S000003653

Description
Endoplasmic reticulum (ER) resident protein required for ER exit of the high-affinity phosphate transporter Pho84p, specifically required for packaging of Pho84p into COPII vesicles

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
unfolded protein binding Kota J and Ljungdahl PO (2005) Specialized membrane-localized chaperones prevent aggregation of polytopic proteins in the ER. J Cell Biol 168(1):79-88
       IMP : Inferred from Mutant Phenotype
Assigned on 2008-07-31 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ER to Golgi vesicle-mediated transport Lau WT, et al. (2000) Pho86p, an endoplasmic reticulum (ER) resident protein in Saccharomyces cerevisiae, is required for ER exit of the high-affinity phosphate transporter Pho84p. Proc Natl Acad Sci U S A 97(3):1107-12
       IMP : Inferred from Mutant Phenotype
Assigned on 2008-07-31 SGD
peptidyl-amino acid modification Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
phosphate transport Lau WT, et al. (2000) Pho86p, an endoplasmic reticulum (ER) resident protein in Saccharomyces cerevisiae, is required for ER exit of the high-affinity phosphate transporter Pho84p. Proc Natl Acad Sci U S A 97(3):1107-12
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-20 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0592
Assigned on 2007-05-23 UniProtKB
protein folding Kota J and Ljungdahl PO (2005) Specialized membrane-localized chaperones prevent aggregation of polytopic proteins in the ER. J Cell Biol 168(1):79-88
       IMP : Inferred from Mutant Phenotype
Assigned on 2005-07-08 SGD
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Lau WT, et al. (2000) Pho86p, an endoplasmic reticulum (ER) resident protein in Saccharomyces cerevisiae, is required for ER exit of the high-affinity phosphate transporter Pho84p. Proc Natl Acad Sci U S A 97(3):1107-12
       IDA : Inferred from Direct Assay
Assigned on 2002-09-20 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forPHO86/YJL117W for PHO86
1) Lau WT, et al. (2000) Pho86p, an endoplasmic reticulum (ER) resident protein in Saccharomyces cerevisiae, is required for ER exit of the high-affinity phosphate transporter Pho84p. Proc Natl Acad Sci U S A 97(3):1107-12

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PHO86/YJL117W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PHO86/YJL117W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MAVQQRK

C-term FKAEHKD

Length(aa) 311

MW(Da) 34,881

pI 10.44

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.207

Codon Adaptation Index 0.191

Frequency of Optimal Codons 0.528

Hydropathicity of Protein 0.001

Aromaticity Score 0.093

10 20 30 40 50 | | | | | MAVQQRKKKEGRKSDKNAPSVPQVDASLDKPLDIDAPPTIYSVNLKPEYG TAALNLSADFIRQEQALANKYLFFHPVILVVLTIGLLIYLTPRIVFPIRN TGSVAGWFYQLARINKKVVLSGLVFTAIGASFLFTLLSRVSDSYFKSKIN QLVGSKGEKVFGINLNDLVARHETKDPVVNNTHIIVYRETPIALISLAPN MTLSTDENLVMSVTTVGCRRVYVKSGIIEDLIDWAMLHSKNIRSSGKYGE TMKLLIDVYSFDSTLKEILKKKGFTYIQSIRVSENRLLGGLFGVKKELWG LQFHFKAEHKD*

Protein Structures from PDB: proteins of known structure with sequence similarity to PHO86/YJL117W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
PHO86 SGD (2007) Information without a citation in SGD

Standard Name	Reference
PHO86	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YJL117W SGD Systematic Sequence

853325 NCBI: Gene ID

NP_012418.1 NCBI: RefSeq protein version ID

NP_012418.1 NCBI: RefSeq protein version ID

6322344 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YJL117W	SGD Systematic Sequence
853325	NCBI: Gene ID
NP_012418.1	NCBI: RefSeq protein version ID
NP_012418.1	NCBI: RefSeq protein version ID
6322344	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
DNA & RNA Details
Topic Research Highlight Reference Contributor
Other DNA & RNA Details Description: Specifically higher expression in phosphorus limited chemostat cultures versus phosphorus excess.
otherTopic: expression
Boer VM, et al. (2003) The genome-wide transcriptional responses of Saccharomyces cerevisiae grown on glucose in aerobic chemostat cultures limited for carbon, nitrogen, phosphorus, or sulfur. J Biol Chem 278(5):3265-74
Viktor Boer
2003-07-25

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
18 curated references; 0 references not yet curated
Mutants/Phenotypes
Strains/Constructs
Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67
       |AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Mutants/Phenotypes
Strains/Constructs
Pagani MA, et al. (2007) Disruption of iron homeostasis in Saccharomyces cerevisiae by high zinc levels: a genome-wide study. Mol Microbiol 65(2):521-37
       |ACO1 |ACO2 |ADE1 |ADE12 |ADE13 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADK1 |AFT1 |AKR1 |ARN1 |MORE
Computational analysis
DNA/RNA Sequence Features
Regulation of
Gonze D, et al. (2005) Discrimination of yeast genes involved in methionine and phosphate metabolism on the basis of upstream motifs. Bioinformatics 21(17):3490-500
         |CYS3 |CYS4 |MET31 |MET32 |MET4 |MUP1 |PHM6 |PHO11 |PHO12 |PHO4 |PHO5 |PHO81 |PHO84 |PHO87 |MORE
Function/Process
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Kota J and Ljungdahl PO (2005) Specialized membrane-localized chaperones prevent aggregation of polytopic proteins in the ER. J Cell Biol 168(1):79-88
       |CHS7 |GAP1 |GSF2 |SHR3
Protein-protein Interactions
Millson SH, et al. (2005) A two-hybrid screen of the yeast proteome for Hsp90 interactors uncovers a novel Hsp90 chaperone requirement in the activity of a stress-activated mitogen-activated protein kinase, Slt2p (Mpk1p). Eukaryot Cell 4(5):849-60
         |ACF4 |ACT1 |AGP2 |AHA1 |AIM2 |AIM37 |ANT1 |AQR1 |ARE1 |ARE2 |ARG4 |ARR3 |ASG7 |ATG14 |MORE
Fungal Related Genes/Proteins
Serrani F and Berardi E (2005) The NII2 gene of Hansenula polymorpha is involved in nitrite assimilation. FEMS Yeast Res 5(11):999-1007

Mutants/Phenotypes
Strains/Constructs
Pinson B, et al. (2004) Low affinity orthophosphate carriers regulate PHO gene expression independently of internal orthophosphate concentration in Saccharomyces cerevisiae. J Biol Chem 279(34):35273-80
       |PHO2 |PHO4 |PHO81 |PHO84 |PHO87 |PHO90 |PHO91 |YHR202W
Mutants/Phenotypes
Serrano R, et al. (2004) Copper and iron are the limiting factors for growth of the yeast Saccharomyces cerevisiae in an alkaline environment. J Biol Chem 279(19):19698-704
           |AFT1 |ATX1 |BEM1 |BSD2 |BUD25 |CCC2 |CCS1 |COX17 |CTR1 |CUP5 |DIA2 |ERG2 |ERG6 |FET3 |MORE
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Almaguer C, et al. (2003) Inositol and phosphate regulate GIT1 transcription and glycerophosphoinositol incorporation in Saccharomyces cerevisiae. Eukaryot Cell 2(4):729-36
     |GIT1 |INO1 |PHO4 |PHO84 |PLB1 |PLB2 |PLB3
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Regulation of
Strains/Constructs
Lau WT, et al. (2000) Pho86p, an endoplasmic reticulum (ER) resident protein in Saccharomyces cerevisiae, is required for ER exit of the high-affinity phosphate transporter Pho84p. Proc Natl Acad Sci U S A 97(3):1107-12
       |PHO5 |PHO84 |PHO85
DNA/RNA Sequence Features
Mutants/Phenotypes
Regulation of
Strains/Constructs
Transcription
Ogawa N, et al. (2000) New components of a system for phosphate accumulation and polyphosphate metabolism in Saccharomyces cerevisiae revealed by genomic expression analysis. Mol Biol Cell 11(12):4309-21
           |CTF19 |GDE1 |HIS1 |HOR2 |PHM6 |PHM7 |PHM8 |PHO11 |PHO12 |PHO4 |PHO5 |PHO8 |PHO80 |PHO81 |MORE
Reviews
Persson BL, et al. (1999) Phosphate permeases of Saccharomyces cerevisiae: structure, function and regulation. Biochim Biophys Acta 1422(3):255-72
       |GTR1 |PHO84 |PHO87 |PHO88 |PHO89
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Lau WW, et al. (1998) A genetic study of signaling processes for repression of PHO5 transcription in Saccharomyces cerevisiae. Genetics 150(4):1349-59
       |ACC1 |PHO23 |PHO5 |PHO80 |PHO81 |PHO84 |PHO85 |PMA1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Bun-ya M, et al. (1996) Two new genes, PHO86 and PHO87, involved in inorganic phosphate uptake in Saccharomyces cerevisiae. Curr Genet 29(4):344-51
       |PHO84 |PHO87
DNA/RNA Sequence Features
Cziepluch C, et al. (1996) Sequencing analysis of a 40.2 kb fragment of yeast chromosome X reveals 19 open reading frames including URA2 (5' end), TRK1, PBS2, SPT10, GCD14, RPE1, PHO86, NCA3, ASF1, CCT7, GZF3, two tRNA genes, three remnant delta elements and a Ty4 transposon. Yeast 12(14):1471-4
     |ASF1 |CCT7 |GCD14 |GZF3 |MTC1 |NCA3 |PBS2 |RPE1 |SPT10 |TRK1 |URA2 |YJL120W
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Yompakdee C, et al. (1996) A putative membrane protein, Pho88p, involved in inorganic phosphate transport in Saccharomyces cerevisiae. Mol Gen Genet 251(5):580-90
     |PHO81 |PHO88
Cellular Location
DNA/RNA Sequence Features
Function/Process
Mutants/Phenotypes
Protein Physical Properties
Protein Sequence Features
Strains/Constructs
Transcription
Yompakdee C, et al. (1996) A putative new membrane protein, Pho86p, in the inorganic phosphate uptake system of Saccharomyces cerevisiae. Gene 171(1):41-7
       |PHO4 |PHO84 |PHO87

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.