PRM10/YJL108C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrX: 218851 to 217700
CDS: 218851 - 217700

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

PRM10 YJL108C ORF, Verified S000003644

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2000-09-05. Gene name expires on 2001-09-05.
Description
Pheromone-regulated protein, proposed to be involved in mating; predicted to have 5 transmembrane segments; induced by treatment with 8-methoxypsoralen and UVA irradiation

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2001-01-19 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
biological_process
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2009-09-25 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
integral to membrane Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2001-01-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forPRM10/YJL108C for PRM10
1) Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

2) Dardalhon M, et al. (2007) Specific transcriptional responses induced by 8-methoxypsoralen and UVA in yeast. FEMS Yeast Res 7(6):866-878

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PRM10/YJL108C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PRM10/YJL108C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MIVSFGD

C-term KTGLFSL

Length(aa) 383

MW(Da) 41,488

pI 7.94

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.182

Codon Adaptation Index 0.172

Frequency of Optimal Codons 0.503

Hydropathicity of Protein 0.679

Aromaticity Score 0.128

10 20 30 40 50 | | | | | MIVSFGDATTRTSEVQLVRCTQGLNLWKLHQVHAVYKRVVHDTLGADEGN ALLDQILADTNLYPPWMCVLLYAFCSAMVTPYAFGGDWVNLAISFFMGLC VGSLQFILSQKSYMYSNVFEISASIVVSFCGRAFGSIPRSHICFGAVTQG SLALILPGYIILCGALELQSRSLVAGAVRMFYAIIYSLFLGFGITLGSAL FGWMYHNATNEISCPQLISPWFRFLFVPAFTISISLLNQAHISQLPVMVF ISCTGYVVTYWAGKHFANSTEFTAALAAFVIGVLGNLYSRIWKGLAVSAM LPAIFVQVPSGIASQNSLLSGLQSANTIVNANETITTSTSDPSSSMSFGM TMIQVCVGISVGLFASSLFVYPFGKKKTGLFSL*

Protein Structures from PDB: proteins of known structure with sequence similarity to PRM10/YJL108C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
PRM10 2000-10-30 Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Sequence Annotation Notes
Date Note
2003-12-02 Based on comparison with related fungi, Kellis et al. propose that YJL107C and YJL108C be merged into a single, larger ORF. SGD has re-sequenced this segment of the chromosome, in S288C, and confirmed the presence of an in-frame stop codon between these two ORFs. Although it is possible that these ORFs are merged in other strains of S. cerevisiae, the systematic sequence will not be changed.
Kellis M, et al. (2003) Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54

Standard Name	Date Standardized	Reference
PRM10	2000-10-30	Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Date	Note
2003-12-02	Based on comparison with related fungi, Kellis et al. propose that YJL107C and YJL108C be merged into a single, larger ORF. SGD has re-sequenced this segment of the chromosome, in S288C, and confirmed the presence of an in-frame stop codon between these two ORFs. Although it is possible that these ORFs are merged in other strains of S. cerevisiae, the systematic sequence will not be changed. *Kellis M, et al.* (2003)** Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YJL108C SGD Systematic Sequence

853336 NCBI: Gene ID

NP_012427.1 NCBI: RefSeq protein version ID

NP_012427.1 NCBI: RefSeq protein version ID

6322353 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YJL108C	SGD Systematic Sequence
853336	NCBI: Gene ID
NP_012427.1	NCBI: RefSeq protein version ID
NP_012427.1	NCBI: RefSeq protein version ID
6322353	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
12 curated references; 0 references not yet curated
RNA Levels and Processing
Regulation of
Garcia R, et al. (2009) The High Osmotic Response and Cell Wall Integrity Pathways Cooperate to Regulate Transcriptional Responses to Zymolyase-induced Cell Wall Stress in Saccharomyces cerevisiae. J Biol Chem 284(16):10901-11
       |AFR1 |ALD3 |ALD4 |ARI1 |BCK1 |BGL2 |CCW14 |CIS3 |CRG1 |CRH1 |CTT1 |CWP1 |CWP2 |DCS2 |MORE
Regulation of
Transcription
Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461
       |AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
Regulation of
Capaldi AP, et al. (2008) Structure and function of a transcriptional network activated by the MAPK Hog1. Nat Genet 40(11):1300-6
       |AHP1 |ALD3 |CTT1 |GPD1 |GPH1 |GRE2 |HOG1 |HOR2 |HOT1 |HSP12 |MSN2 |MSN4 |NCE103 |PGM2 |MORE
RNA Levels and Processing
Regulation of
Nunez LR, et al. (2008) Cell wall integrity MAPK pathway is essential for lipid homeostasis. J Biol Chem 283(49):34204-17
       |BCK1 |BGL2 |CCW14 |CHO2 |CHS6 |CHS7 |CKI1 |CRH1 |FLC2 |GFA1 |GIC2 |HSP150 |IME2 |INO1 |MORE
RNA Levels and Processing
Regulation of
Dardalhon M, et al. (2007) Specific transcriptional responses induced by 8-methoxypsoralen and UVA in yeast. FEMS Yeast Res 7(6):866-878
       |AAD6 |ARG3 |ARG5,6 |ARG80 |BCH2 |CDC27 |CDC45 |COT1 |CTF19 |DDI2 |DIN7 |DUN1 |ECL1 |ECM13 |MORE
RNA Levels and Processing
Liu X, et al. (2007) Genetic and Comparative Transcriptome Analysis of Bromodomain Factor 1 in the Salt Stress Response of Saccharomyces cerevisiae. Curr Microbiol 54(4):325-30
         |ACS2 |ADH2 |AGX1 |ALD2 |ALD3 |APE3 |ARI1 |ARO10 |ARO9 |ATG33 |BAP2 |BDF1 |BDF2 |BDH2 |MORE
Protein Processing/Modification/Regulation
Protein Sequence Features
Strains/Constructs
Techniques and Reagents
Mah AS, et al. (2005) Substrate specificity analysis of protein kinase complex Dbf2-Mob1 by peptide library and proteome array screening. BMC Biochem 6():22
           |ABF2 |ADD37 |ADH7 |ADK1 |AIM17 |AIM3 |AMD1 |ARC1 |AVT3 |AVT4 |BDF2 |BFR2 |CBF1 |CDC13 |MORE
Regulation of
Boorsma A, et al. (2004) Characterization of the transcriptional response to cell wall stress in Saccharomyces cerevisiae. Yeast 21(5):413-27
           |AFR1 |ASH1 |BGL2 |CCW14 |CIS3 |CRG1 |CRH1 |CRZ1 |CWP1 |CWP2 |DDR2 |DDR48 |ECM4 |FBP26 |MORE
DNA/RNA Sequence Features
Fungal Related Genes/Proteins
Brachat S, et al. (2003) Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii. Genome Biol 4(7):R45
     |BBC1 |CMC4 |COA2 |MPS3 |NCS6 |PCC1 |PTK1 |SKG1 |SUS1 |SWH1 |TMA23 |VMA9 |YBL039W-B |YBL104C |MORE
RNA Levels and Processing
Regulation of
Harris K, et al. (2001) Role of scaffolds in MAP kinase pathway specificity revealed by custom design of pathway-dedicated signaling proteins. Curr Biol 11(23):1815-24
             |AFR1 |AGA1 |ARI1 |ASG7 |CIK1 |CRG1 |CWP1 |DAK1 |DSF1 |FUS1 |FUS2 |GPD1 |GRE2 |HYM1 |MORE
Function/Process
Protein Sequence Features
Regulation of
Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       |AGA1 |PRM1 |PRM2 |PRM3 |PRM4 |PRM5 |PRM6 |PRM7 |PRM8 |PRM9
DNA/RNA Sequence Features
Non-Fungal Related Genes/Proteins
Sychrova H, et al. (2000) Organization of specific genomic regions of Zygosaccharomyces rouxii and Pichia sorbitophila: comparison with Saccharomyces cerevisiae. Yeast 16(15):1377-85
       |ADE2 |AIM17 |AIM5 |HIS3 |MRP7 |RGD1 |TAE1 |YJL107C

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.