PRY1/YJL079C Single Page Format

Help

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

SGD Locus Page

Names and Identifiers [TOP] [NEXT] Help
Standard Name Systematic Name Alias Feature Type SGDID
PRY1 YJL079C   ORF, Verified S000003615
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 1999-04-12. Gene name expires on 2000-04-12.
Description
Protein of unknown function

GO Annotations [TOP] [NEXT] Help
Molecular Function
Annotation(s)Reference(s)EvidenceAssigned By
molecular_function
unknown
SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
SGD Papers Entry  
ND : No Biological Data Available
Assigned on 2002-11-26
SGD
Biological Process
Annotation(s)Reference(s)EvidenceAssigned By
biological_process
unknown
SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
SGD Papers Entry  
ND : No Biological Data Available
Assigned on 2002-11-26
SGD
translational elongationHuttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
SGD Papers Entry  
RCA : Reviewed Computational Analysis
Assigned on 2009-08-06
bioPIXIE_MEFIT
Cellular Component
Annotation(s)Reference(s)EvidenceAssigned By
endoplasmic reticulumKumar A, et al. (2002) Subcellular localization of the yeast proteome. Genes Dev 16(6):707-19
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  Web Supplement  yfgdb  
IDA : Inferred from Direct Assay
Assigned on 2002-05-07
SGD
extracellular regionTerashima H, et al. (2002) Sequence-based approach for identification of cell wall proteins in Saccharomyces cerevisiae. Curr Genet 40(5):311-6
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IDA : Inferred from Direct Assay
Assigned on 2004-01-14
SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR001283 , EBI:IPR018244
Assigned on 2007-05-23
UniProtKB
fungal-type vacuoleHuh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91
SGD Papers Entry  Pubmed Entry  Web Supplement  yfgdb  
IDA : Inferred from Direct Assay
Assigned on 2003-10-28
SGD
nuclear envelopeKumar A, et al. (2002) Subcellular localization of the yeast proteome. Genes Dev 16(6):707-19
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  Web Supplement  yfgdb  
IDA : Inferred from Direct Assay
Assigned on 2002-05-07
SGD

Pathways [TOP] [NEXT] Help
No pathways available

Summary Paragraph [TOP] [NEXT] Help
No summary paragraph available

Basic References [TOP]   Help
BASIC INFORMATION REFERENCES forPRY1/YJL079C for PRY1
1)SGD (2006) No information available
SGD Papers Entry  
2)Ku, T. et al. (1996) Characterization of the PRY Genes: Yeast homologs of the plant PR-1 proteins. Unpublished
SGD Papers Entry  

Mutant Phenotypes [TOP] [NEXT] Help
Phenotype page for PRY1/YJL079C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT] Help
Interaction page for PRY1/YJL079C

Homologs [TOP] [NEXT] Help
  • Comparison Resources
  • Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT] Help
    Protein Sequence Calculations
    from Predicted Full length Translation
    N-term MKLSKLS
    C-term DNVEPLA
    Length(aa) 299
    MW(Da) 30,634
    pI 4.3
    Amino Acid Composition (full length)
    GCG tools: PepPlot, Helical Wheel, PepStruct

    Transcript Translation Calculations
    Codon Bias 0.405  
    Codon Adaptation Index 0.297  
    Frequency of Optimal Codons 0.635  
    Hydropathicity of Protein -0.176  
    Aromaticity Score 0.074  

                              10        20        30        40        50
                               |         |         |         |         |
                      MKLSKLSILTSALATSALAAPAVVTVTEHAHEAAVVTVQGVVYVENGQTR
                      TTYETLAPASTATPTSTATALVAPPVAPSSASSNSDVVLSALKNLASVWG
                      KTTDSTTTLTSSESTSQSLAQATTTSTPAAASTTSTPAATTTTSQAAATS
                      SASSSDSDLSDFASSVLAEHNKKRALHKDTPALSWSDTLASYAQDYADNY
                      DCSGTLTHSGGPYGENLALGYDGPAAVDAWYNEISNYDFSNPGFSSNTGH
                      FTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAGNYEGEYADNVEPLA*
    

    Protein Structures from PDB: proteins of known structure with sequence similarity to PRY1/YJL079C, based on Smith-Waterman analysis. [TOP] [NEXT] Help
    PDB protein structure(s) homologous to PRY1Homolog Source (per PDB)Protein Alignment: PRY1 vs. HomologExternal Links
    P-Value%Identical%SimilarAlignment
    1smb ( Chain: A)
    Crystal structure of golgi-associated pr-1 protein
  • PDB_Info
  • PDB_Structure
  • Homo sapiens3.2e-144122View alignmentSCOP
    MMDB
    CATH
    1cfe ( Chain: A)
    P14a, nmr, 20 structures
  • PDB_Info
  • PDB_Structure
  • Solanum lycopersicum5.7e-134126View alignmentSCOP
    MMDB
    CATH
    1qnx ( Chain: A)
    Ves v 5, an allergen from vespula vulgaris venom
  • PDB_Info
  • PDB_Structure
  • Vespula vulgaris2.0e-083624View alignmentSCOP
    MMDB
    CATH
    1xta ( Chain: B, A)
    Crystal structure of natrin, a snake venom crisp from taiwan cobra (naja atra)
  • PDB_Info
  • PDB_Structure
  • Naja atraChain B = 3.4e-073228View alignmentSCOP
    MMDB
    CATH
    Chain A = 3.4e-073228View alignment
    1xx5 ( Chain: B, C, A)
    Crystal structure of natrin from naja atra snake venom
  • PDB_Info
  • PDB_Structure
  • Naja atraChain B = 3.9e-073131View alignmentSCOP
    MMDB
    CATH
    Chain C = 3.9e-073131View alignment
    Chain A = 3.9e-073131View alignment
    2giz ( Chain: B, A)
    Structural and functional analysis of natrin, a member of crisp-3 family blocks a variety of ion channels
  • PDB_Info
  • PDB_Structure
  • Naja atraChain B = 3.9e-073131View alignmentSCOP
    MMDB
    CATH
    Chain A = 3.9e-073131View alignment
    2epf ( Chain: D, A, C, B)
    Crystal structure of zinc-bound pseudecin from pseudechis porphyriacus
  • PDB_Info
  • PDB_Structure
  • Pseudechis porphyriacusChain D = 9.1e-073127View alignmentSCOP
    MMDB
    CATH
    Chain A = 9.1e-073127View alignment
    Chain C = 9.1e-073127View alignment
    Chain B = 9.1e-073127View alignment
    2ddb ( Chain: D, B, A, C)
    Crystal structure of pseudecin from pseudechis porphyriacus
  • PDB_Info
  • PDB_Structure
  • Pseudechis porphyriacusChain D = 9.1e-073127View alignmentSCOP
    MMDB
    CATH
    Chain B = 9.1e-073127View alignment
    Chain A = 9.1e-073127View alignment
    Chain C = 9.1e-073127View alignment
    2vzn ( Chain: A, B)
    Crystal structure of the major allergen from fire ant venom, sol i 3
  • PDB_Info
  • PDB_Structure
  • Solenopsis invictaChain A = 1.7e-063225View alignmentSCOP
    MMDB
    CATH
    Chain B = 1.7e-063225View alignment
    2dda ( Chain: B, A, C, D)
    Crystal structure of pseudechetoxin from pseudechis australis
  • PDB_Info
  • PDB_Structure
  • Pseudechis australisChain B = 2.2e-063126View alignmentSCOP
    MMDB
    CATH
    Chain A = 2.2e-063126View alignment
    Chain C = 2.2e-063126View alignment
    Chain D = 2.2e-063126View alignment
    1u53 ( Chain: A)
    Novel x-ray structure of na-asp-2, a pr-1 protein from the nematode parasite necator americanus and a vaccine antigen for human hookworm infection
  • PDB_Info
  • PDB_Structure
  • Necator americanus3.1e-053432View alignmentSCOP
    MMDB
    CATH
    1rc9 ( Chain: A)
    Crystal structure of stecrisp, a member of crisp family from trimeresurus stejnegeri refined at 1.6 angstroms resolution: structual relationship of the two domains
  • PDB_Info
  • PDB_Structure
  • Viridovipera stejnegeri0.0001902729View alignmentSCOP
    MMDB
    CATH
    1wvr ( Chain: A)
    Crystal structure of a crisp family ca-channel blocker derived from snake venom
  • PDB_Info
  • PDB_Structure
  • Trimeresurus flavoviridis0.0004102927View alignmentSCOP
    MMDB
    CATH

    Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT] Help
  • Functional Analysis
  • You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

    Locus History (misc. notes) [TOP] [NEXT] Help
    Nomenclature History
    Standard NameDate StandardizedReference
    PRY12001-10-19Ku, T. et al. (1996) Characterization of the PRY Genes: Yeast homologs of the plant PR-1 proteins. Unpublished
    SGD Papers Entry  

    Sequence Retrieval [TOP] [NEXT] Help
    Sequence Type Output Format
    Genomic DNA GCG | FASTA | NoHeader
    Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader
    DNA coding sequence
    (without introns, without flanking regions)
    GCG | FASTA | NoHeader
    Protein Translation of ORF GCG | FASTA | NoHeader
    6-Frame Translation(with Restriction Map) GCG
    Restriction Fragment Sizes GCG
  • Sequence Analysis Tools
  • Sequence from other databases
    Sequence IDSource
    YJL079CSGD Systematic Sequence
    853366NCBI: Gene ID
    NP_012456.1NCBI: RefSeq protein version ID
    NP_012456.1NCBI: RefSeq protein version ID
    6322382NCBI: NCBI protein GI

    Map and Displays [TOP] [NEXT] Help
    Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
    Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map  

    Localization [TOP] [NEXT] Help
  • Localization Resources
  • Community Annotation [TOP] [NEXT] Help
    No community annotation available.

    Literature Guide: papers categorized by topic. [TOP]   Help
    TopicsReferenceOther Genes Addressed
    14 curated references; 0 references not yet curated
    RNA Levels and Processing
    Regulation of
    Garcia R, et al. (2009) The High Osmotic Response and Cell Wall Integrity Pathways Cooperate to Regulate Transcriptional Responses to Zymolyase-induced Cell Wall Stress in Saccharomyces cerevisiae. J Biol Chem 284(16):10901-11
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AFR1 |ALD3 |ALD4 |ARI1 |BCK1 |BGL2 |CCW14 |CIS3 |CRG1 |CRH1 |CTT1 |CWP1 |CWP2 |DCS2 |MORE
    RNA Levels and Processing
    Regulation of
    Roberts GG 3rd and Hudson AP (2009) Rsf1p is required for an efficient metabolic shift from fermentative to glycerol-based respiratory growth in S. cerevisiae. Yeast 26(2):95-110
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  Web Supplement  
    |ABC1 |ACH1 |AEP2 |AGP2 |AGX1 |AHP1 |AIM33 |AIM39 |ANB1 |ARN1 |ARN2 |ATG3 |ATP1 |ATP10 |MORE
    Evolution
    Fungal Related Genes/Proteins
    Coronado JE, et al. (2007) Conserved processes and lineage-specific proteins in fungal cell wall evolution. Eukaryot Cell 6(12):2269-77
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACF2 |AGA1 |AGA2 |ANS1 |BAR1 |BGL2 |BSC1 |CCW12 |CCW14 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |MORE
    Protein-Nucleic Acid Interactions
    RNA Levels and Processing
    Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
    Regulation of
    Transcription
    Buck MJ and Lieb JD (2006) A chromatin-mediated mechanism for specification of conditional transcription factor targets. Nat Genet 38(12):1446-51
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |ACA1 |ACS1 |ADE3 |ADH1 |AGP1 |AIM38 |ANP1 |AQY1 |ASC1 |AST2 |ATG19 |AZF1 |BDF1 |BSC3 |MORE
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Barwell KJ, et al. (2005) Relationship of DFG16 to the Rim101p pH response pathway in Saccharomyces cerevisiae and Candida albicans. Eukaryot Cell 4(5):890-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ASN1 |DFG16 |GPH1 |RIM101 |RIM21 |YGR122W
    DNA/RNA Sequence Features
    Regulation of
    Transcription
    Vyas VK, et al. (2005) Repressors Nrg1 and Nrg2 regulate a set of stress-responsive genes in Saccharomyces cerevisiae. Eukaryot Cell 4(11):1882-91
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ADK2 |AGA2 |AGP2 |AIM13 |AIM19 |AIM34 |AIM36 |ALD4 |ASG7 |ATP15 |ATP16 |ATP17 |ATP18 |ATP2 |MORE
    Reviews
    Rutherford JC and Bird AJ (2004) Metal-responsive transcription factors that regulate iron, zinc, and copper homeostasis in eukaryotic cells. Eukaryot Cell 3(1):1-13
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |ADE17 |ADH4 |AFT1 |AFT2 |AKR1 |ARN1 |ARN2 |ATX1 |BAG7 |BNA2 |CCC2 |COS1 |COS2 |COS3 |MORE
    Regulation of
    Transcription
    Barz T, et al. (2003) Genome-wide expression screens indicate a global role for protein kinase CK2 in chromatin remodeling. J Cell Sci 116(Pt 8):1563-77
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |AGP1 |AIM3 |ARG1 |ARG5,6 |ARO10 |ARO9 |ATR1 |BAT1 |BNA5 |CIT2 |CKA1 |CKA2 |CKB1 |CKB2 |MORE
    Cellular Location
    Strains/Constructs
    Huh WK, et al. (2003) Global analysis of protein localization in budding yeast. Nature 425(6959):686-91
    SGD Papers Entry  Pubmed Entry  Web Supplement  yfgdb  
    |AAH1 |AAP1 |ABZ1 |ABZ2 |ACB1 |ACO2 |ADD37 |ADD66 |ADE1 |ADE12 |ADE2 |ADE3 |ADE4 |ADE6 |MORE
    Cellular Location
    Mutants/Phenotypes
    Protein Sequence Features
    Strains/Constructs
    Techniques and Reagents
    Terashima H, et al. (2002) Sequence-based approach for identification of cell wall proteins in Saccharomyces cerevisiae. Curr Genet 40(5):311-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CWC23 |DIA3 |DSE2 |DSE4 |EAR1 |ERJ5 |GRX7 |HPF1 |MNL1 |PAN5 |PGU1 |PRY2 |SLP1 |SPC25 |MORE
    DNA/RNA Sequence Features
    Regulation of
    Transcription
    Iyer VR, et al. (2001) Genomic binding sites of the yeast cell-cycle transcription factors SBF and MBF. Nature 409(6819):533-8
    SGD Papers Entry  Pubmed Entry  Web Supplement  yfgdb  
    |ABF1 |APN1 |BBP1 |BUD9 |CAP1 |CDC21 |CDC45 |CDC7 |CLA4 |CLB1 |CLB2 |CLB6 |CLD1 |CLN1 |MORE
    Function/Process
    RNA Levels and Processing
    Miura S, et al. (2000) Screening of genes involved in isooctane tolerance in saccharomyces cerevisiae by using mRNA differential display Appl Environ Microbiol 66(11):4883-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |GAC1 |HAC1 |ICT1 |JEN1 |KRE1 |MAL11 |MUQ1 |PRY2 |PRY3
    Mutants/Phenotypes
    Strains/Constructs
    Entian KD, et al. (1999) Functional analysis of 150 deletion mutants in Saccharomyces cerevisiae by a systematic approach. Mol Gen Genet 262(4-5):683-702
    SGD Papers Entry  Pubmed Entry  
    |ABM1 |AIM3 |ALT1 |AMN1 |APD1 |APL2 |AVT3 |BIO3 |BIO4 |BIO5 |BNA3 |BUD4 |CFD1 |CHA4 |MORE


    Return to SGD
    Send a Message to the SGD Curators

    SGDtm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.