---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP82/YJL061W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrX: 320010 to 322151 CDS: 320010 - 322151 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP82	YJL061W	HRB187	ORF, Verified	S000003597
Description
Nucleoporin, subunit of the nuclear pore complex (NPC); forms a subcomplex with Gle2p, Nup159p, Nsp1p, and Nup116p and is required for proper localization of Nup116p in the NPC

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Nup82 complex Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51        IDA : Inferred from Direct Assay Assigned on 2009-10-14 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP82/YJL061W for NUP82 NUP82 encodes an essential nuclear pore protein that was first isolated by its physical association with Nsp1p (1, 2, 3). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 3, 4, 5, 6). The structure of the vertebrate NPC has been studied extensively; recent reviews include 7, 8, 9, and 10. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (11, 12). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 3, 4, 13, 14, 15). The Nup82p-Nsp1p subcomplex also includes Nup159p (16), and is found exclusively at the cytoplasmic periphery of the nuclear pore (17). This complex is distinct from the subcomplex comprising Nsp1p, Nup49p, Nup57p, and Nic96p (3). PI,PF,PH,PR, At the Nup82Delta108 restrictive temperature, Nup159p is lost from the nuclear pore (16). Mutations in NUP82 are synthetically lethal with mutations in several other nucleoporin genes (3). Last Updated: 1999-07-30

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP82/YJL061W for NUP82 1) Grandi P, et al. (1995) A novel nuclear pore protein Nup82p which specifically binds to a fraction of Nsp1p. J Cell Biol 130(6):1263-73      2) Hurwitz ME and Blobel G (1995) NUP82 is an essential yeast nucleoporin required for poly(A)+ RNA export. J Cell Biol 130(6):1275-81      3) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      4) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    5) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      6) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      7) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      8) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      9) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      10) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      11) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      12) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        13) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      14) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        15) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      16) Belgareh N, et al. (1998) Functional characterization of a Nup159p-containing nuclear pore subcomplex. Mol Biol Cell 9(12):3475-92        17) Fahrenkrog B, et al. (1998) Molecular architecture of the yeast nuclear pore complex: localization of Nsp1p subcomplexes. J Cell Biol 143(3):577-88        18) Ho AK, et al. (2000) Assembly and preferential localization of Nup116p on the cytoplasmic face of the nuclear pore complex by interaction with Nup82p. Mol Cell Biol 20(15):5736-48        19) Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP82/YJL061W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP82/YJL061W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSQSSRL C-term EFTTKTQ Length(aa) 713 MW(Da) 82,085 pI 5.09 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.057   Codon Adaptation Index 0.155   Frequency of Optimal Codons 0.459   Hydropathicity of Protein -0.345   Aromaticity Score 0.090

10 20 30 40 50 | | | | | MSQSSRLSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLT DSLYHSLNFSRHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNV EDVSIQDAFQIFHYSIDEEEVGPKSSIKKVLFHPKSYRDSCIVVLKEDDT ITMFDILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTLYCLNTT EGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTDVIVKRNVI KQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTAT NIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVL IERVKLQREIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINES DLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALMSNKTLTFQNI SSDMKPQSTAAETSISTEKSDTVGDGFKMSFTQPINEILILNDNFQKACI SPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIVKAQTLGVSIH NRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELME RFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKS LQQDLSYLKSELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEE LLQVSQEFTTKTQ*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP82/YJL061W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP82	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YJL061W	SGD Systematic Sequence
853385	NCBI: Gene ID
NP_012474.1	NCBI: RefSeq protein version ID
NP_012474.1	NCBI: RefSeq protein version ID
6322400	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
54 curated references; 0 references not yet curated
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NIC96 |NMD5 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP159 |MORE
Protein-protein Interactions	Luo Y, et al. (2010) Resolving the Composition of Protein Complexes Using a MALDI LTQ Orbitrap. J Am Soc Mass Spectrom 21(1):34-46	|APL1 |APL3 |APM4 |APS2 |ASM4 |BMH2 |EDE1 |FKS1 |NIC96 |NSP1 |NUP120 |NUP133 |NUP145 |NUP159 |MORE
RNA Levels and Processing	Chen AK, et al. (2009) Response of Saccharomyces cerevisiae to stress-free acidification. J Microbiol 47(1):1-8	|ACE2 |ACO1 |ARN1 |ARN2 |ARP4 |ATP1 |ATP16 |ATP2 |ATP3 |BRF1 |CAP1 |CAP2 |CBF5 |CCC2 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Dawson TR, et al. (2009) ER membrane-bending proteins are necessary for de novo nuclear pore formation. J Cell Biol 184(5):659-75	|GLE2 |NEM1 |NIC96 |NUP116 |NUP120 |NUP133 |NUP145 |NUP188 |NUP49 |NUP84 |NUP85 |POM152 |POM34 |RTN1 |MORE
Evolution Non-Fungal Related Genes/Proteins	DeGrasse JA, et al. (2009) Evidence for a shared nuclear pore complex architecture that is conserved from the last common eukaryotic ancestor. Mol Cell Proteomics 8(9):2119-30	|MLP1 |MLP2 |NIC96 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |NUP2 |NUP84 |NUP85
Cellular Location Strains/Constructs	Flemming D, et al. (2009) Two structurally distinct domains of the nucleoporin Nup170 cooperate to tether a subset of nucleoporins to nuclear pores. J Cell Biol 185(3):387-95	|NUP1 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |POM152 |POM34
Cellular Location Regulation of	Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73	|APQ12 |ASM4 |GLE1 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP1 |NUP100 |NUP133 |NUP157 |NUP159 |MORE
Cellular Location Strains/Constructs	Onischenko E, et al. (2009) Role of the Ndc1 interaction network in yeast nuclear pore complex assembly and maintenance. J Cell Biol 185(3):475-91	|ASM4 |MPS3 |NDC1 |NPL3 |NUP133 |NUP157 |NUP170 |NUP188 |NUP2 |NUP53 |POM152 |POM34
Reviews	Rexach M (2009) Piecing together nuclear pore complex assembly during interphase. J Cell Biol 185(3):377-9	|ASM4 |NDC1 |NIC96 |NUP157 |NUP170 |NUP188 |NUP53 |NUP84 |POM152 |POM34 |RTN1 |YOP1
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hung NJ, et al. (2008) Arx1 Is a Nuclear Export Receptor for the 60S Ribosomal Subunit in Yeast. Mol Biol Cell 19(2):735-44	|ARX1 |CRM1 |GLE2 |MEX67 |MTR2 |NIC96 |NMD3 |NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP42 |NUP57 |MORE
Protein-protein Interactions	Tarassov K, et al. (2008) An in vivo map of the yeast protein interactome. Science 320(5882):1465-70	|ACT1 |ARC40 |ARP2 |ATG27 |BEM1 |CDC11 |CHC1 |DHH1 |FMP42 |GYL1 |KEL1 |KEL2 |LAS17 |LSM4 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Yao W, et al. (2008) A versatile interaction platform on the Mex67-Mtr2 receptor creates an overlap between mRNA and ribosome export. EMBO J 27(1):6-16	|MEX67 |MTR2 |NMD3 |NUP116 |NUP120 |NUP145 |NUP159 |NUP84 |NUP85 |SEC13 |SEH1
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Reviews	Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73	|ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |MORE
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96	|GLE1 |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP157 |NUP159 |NUP170 |NUP192 |MORE
Cellular Location Protein-protein Interactions	Stelter P, et al. (2007) Molecular basis for the functional interaction of dynein light chain with the nuclear-pore complex. Nat Cell Biol 9(7):788-96	|DYN1 |DYN2 |NSP1 |NUP133 |NUP159 |PEX14
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Protein-protein Interactions	West M, et al. (2007) Novel interaction of the 60S ribosomal subunit export adapter Nmd3 at the nuclear pore complex. J Biol Chem 282(19):14028-37	|CRM1 |NIC96 |NMD3 |NUP159 |NUP85
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Miao M, et al. (2006) The integral membrane protein pom34p functionally links nucleoporin subcomplexes. Genetics 172(3):1441-57	|ASM4 |GLE2 |NSP1 |NUP100 |NUP116 |NUP120 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |NUP57 |POM152 |POM34 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Quan X, et al. (2006) The carrier Msn5p/Kap142p promotes nuclear export of the hsp70 Ssa4p and relocates in response to stress. Mol Microbiol 62(2):592-609	|CRM1 |FAR1 |KAP114 |MIG1 |MSN5 |NMD5 |PHO4 |SSA4
Mutants/Phenotypes Strains/Constructs	Belanger KD, et al. (2005) Nuclear pore complex function in Saccharomyces cerevisiae is influenced by glycosylation of the transmembrane nucleoporin Pom152p. Genetics 171(3):935-47	|ALG12 |NIC96 |NUP1 |NUP116 |POM152
Protein Physical Properties Protein-protein Interactions Strains/Constructs	Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51	|GLE2 |KAP123 |MEX67 |MLP1 |NIC96 |NSP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP49 |MORE
Alias Genetic Interactions Mutants/Phenotypes Strains/Constructs	Belanger KD, et al. (2004) The karyopherin Msn5/Kap142 requires Nup82 for nuclear export and performs a function distinct from translocation in RPA protein import. J Biol Chem 279(42):43530-9	|KAP123 |KAP95 |MSN5 |NUP1 |PHO4 |PSE1 |RFA2
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |MORE
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Damelin M and Silver PA (2002) In situ analysis of spatial relationships between proteins of the nuclear pore complex. Biophys J 83(6):3626-36	|NIC96 |NUP116 |NUP120
Cellular Location Protein-protein Interactions	Bailer SM, et al. (2001) The Nsp1p carboxy-terminal domain is organized into functionally distinct coiled-coil regions required for assembly of nucleoporin subcomplexes and nucleocytoplasmic transport. Mol Cell Biol 21(23):7944-55	|NIC96 |NSP1 |NUP49 |NUP57
Function/Process Mutants/Phenotypes Strains/Constructs	Gleizes PE, et al. (2001) Ultrastructural localization of rRNA shows defective nuclear export of preribosomes in mutants of the Nup82p complex. J Cell Biol 155(6):923-36	|DBP5 |GLE1 |GSP1 |NSP1 |NUP159 |NUP84
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Cellular Location Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Bailer SM, et al. (2000) Nup116p associates with the Nup82p-Nsp1p-Nup159p nucleoporin complex. J Biol Chem 275(31):23540-8	|GLE2 |NSP1 |NUP116 |NUP159
Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs Techniques and Reagents	Ho AK, et al. (2000) Assembly and preferential localization of Nup116p on the cytoplasmic face of the nuclear pore complex by interaction with Nup82p. Mol Cell Biol 20(15):5736-48	|GLE1 |NSP1 |NUP116 |NUP159
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Reviews	Ryan KJ and Wente SR (2000) The nuclear pore complex: a protein machine bridging the nucleus and cytoplasm. Curr Opin Cell Biol 12(3):361-71	|CRM1 |GLE1 |KAP104 |KAP123 |KAP95 |LOS1 |MSN5 |MTR10 |NIC96 |NMD5 |NSP1 |NUP116 |NUP159 |NUP170 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Stage-Zimmermann T, et al. (2000) Factors affecting nuclear export of the 60S ribosomal subunit in vivo. Mol Biol Cell 11(11):3777-89	|CRM1 |CSE1 |DBP5 |FAL1 |GLE1 |GLE2 |KAP104 |KAP120 |KAP123 |KAP95 |MEX67 |MSN5 |MTR10 |MTR2 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Moy TI and Silver PA (1999) Nuclear export of the small ribosomal subunit requires the ran-GTPase cycle and certain nucleoporins. Genes Dev 13(16):2118-33	|CRM1 |CSE1 |ITS1-1 |ITS1-2 |KAP95 |KEM1 |MTR10 |PSE1 |SRP1
Other Features	Seedorf M, et al. (1999) Interactions between a nuclear transporter and a subset of nuclear pore complex proteins depend on Ran GTPase. Mol Cell Biol 19(2):1547-57	|CRM1 |GLE2 |GSP1 |KAP95 |NSP1 |NUP1 |NUP116 |NUP145 |NUP159 |POM152 |PSE1 |RNA1 |SRM1 |SRP1 |MORE
Reviews	Strasser K and Hurt E (1999) Nuclear RNA export in yeast. FEBS Lett 452(1-2):77-81	|GLE1 |MEX67 |MTR10 |MTR2 |NPL3 |NSP1 |NUP120 |NUP145 |NUP159 |NUP85
Function/Process Mutants/Phenotypes Protein-protein Interactions	Belgareh N, et al. (1998) Functional characterization of a Nup159p-containing nuclear pore subcomplex. Mol Biol Cell 9(12):3475-92	|NIC96 |NSP1 |NUP159
Cellular Location Function/Process Techniques and Reagents	Bucci M and Wente SR (1998) A novel fluorescence-based genetic strategy identifies mutants of Saccharomyces cerevisiae defective for nuclear pore complex assembly. Mol Biol Cell 9(9):2439-61	|GLE2 |NIC96 |NSP1 |NUP116 |NUP120 |NUP145 |NUP159 |NUP49 |NUP57 |POM152
Cellular Location Function/Process Strains/Constructs Techniques and Reagents	Fahrenkrog B, et al. (1998) Molecular architecture of the yeast nuclear pore complex: localization of Nsp1p subcomplexes. J Cell Biol 143(3):577-88	|NIC96 |NSP1 |NUP49 |NUP57
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Hurwitz ME, et al. (1998) Two yeast nuclear pore complex proteins involved in mRNA export form a cytoplasmically oriented subcomplex. Proc Natl Acad Sci U S A 95(19):11241-5	|GLE1 |NUP159
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |MORE
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kenna MA, et al. (1996) Yeast N1e3p/Nup170p is required for normal stoichiometry of FG nucleoporins within the nuclear pore complex. Mol Cell Biol 16(5):2025-36	|NUP1 |NUP157 |NUP170 |NUP2 |RNA1 |SRP1 |YRB1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Shulga N, et al. (1996) In vivo nuclear transport kinetics in Saccharomyces cerevisiae: a role for heat shock protein 70 during targeting and translocation. J Cell Biol 135(2):329-39	|SRP1 |SSA1
Reviews	Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41	|NIC96 |NUP100 |NUP116 |NUP133 |NUP159 |NUP188 |NUP2 |NUP57 |NUP84 |NUP85 |POM152
Cellular Location Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Protein-protein Interactions Strains/Constructs	Grandi P, et al. (1995) A novel nuclear pore protein Nup82p which specifically binds to a fraction of Nsp1p. J Cell Biol 130(6):1263-73	|NIC96 |NSP1 |NUP49 |NUP57
Cellular Location Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Strains/Constructs	Hurwitz ME and Blobel G (1995) NUP82 is an essential yeast nucleoporin required for poly(A)+ RNA export. J Cell Biol 130(6):1275-81

Return to SGD

Send a Message to the SGD Curators