NUP192/YJL039C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrX: 373793 to 368742
CDS: 373793 - 368742

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

NUP192 YJL039C ORF, Verified S000003576

Description
Essential structural subunit of the nuclear pore complex (NPC), localizes to the nuclear periphery of nuclear pores, homologous to human p205

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
structural constituent of nuclear pore Kosova B, et al. (1999) Nup192p is a conserved nucleoporin with a preferential location at the inner site of the nuclear membrane. J Biol Chem 274(32):22646-51
       IPI : Inferred from Physical Interaction
IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-01 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0509
Assigned on 2007-05-23 UniProtKB
nuclear pore organization Kosova B, et al. (1999) Nup192p is a conserved nucleoporin with a preferential location at the inner site of the nuclear membrane. J Biol Chem 274(32):22646-51
       IPI : Inferred from Physical Interaction
IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-01 SGD
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
regulation of transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0811
Assigned on 2009-10-01 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
nuclear pore Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75
       TAS : Traceable Author Statement
Assigned on 2002-03-13 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0906
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0185
Assigned on 2009-05-06 UniProtKB
nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0539
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forNUP192/YJL039C for NUP192
1) Kosova B, et al. (1999) Nup192p is a conserved nucleoporin with a preferential location at the inner site of the nuclear membrane. J Biol Chem 274(32):22646-51

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP192/YJL039C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP192/YJL039C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MKWSAIP

C-term TGYQNND

Length(aa) 1,683

MW(Da) 191,533

pI 5.06

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.062

Codon Adaptation Index 0.148

Frequency of Optimal Codons 0.448

Hydropathicity of Protein 0.013

Aromaticity Score 0.112

10 20 30 40 50 | | | | | MKWSAIPFQTLYRSIESGEFDFDLFKEVLPDLQNLNLNTDKLKNNASRSQ LEKGEIELSDGSTFKVNQEFIFEAISLSDELNLDEIVACELILSGDTTAN NGKVQYFLRRQYILQIVSFIVNCFHEDTELYQELIKNGALVSNILSAFKF IHTQLSEIKQQINKAQILENYNALFQQNIKFRRDFLLREYDILSQILYGL VDKGAIMKNKDFILSLLHHVSELDSNDFFIIYYTPAFFHLFASLRVLPDA DVKLLHSQFMKDLKDDSIYTKPVKVALIFIFFAYFIGWCKEDPKRRADTM DFKTDVDEPMTSAVELGAIEQILIFAADTSIVEQDKSMELFYDIRSLLER HIPRLIPKQLLDDEKIFSQTTNSTYNPASATDNMSGRGLWNPSYPGMMST TGTARLNSMPNNVNEYSYTTIVLSDQTQEFFLSSFDDVLQTIITDCAFLL TKIKDAEEDSLLSGEDLTLDDISLKADLERFFLSIYFFYASRPEYSCTFW SDKESNAYGFIEWCSRCNDNLMRSCFYLMVSSLSFGPENALNVYHYFGEN SSISWKNIAQCLSDYTKKISNFNSSLHKRQQFSESTHNDIDSTAVALEEG LNEEAVIFLSSLLTLVGSVTYQVDEDVKSSLSKVFSDVLFEFTKINTPLV GAAFKVISNLVPKLESSRTKFWSFLDSLIFKDSSLNYSSESYRNAFTNVL TKYSDVLGFLQLFHNLISIHSRENNSEYMVFGKLAFPTRLGQGYRKVGIW PYFDYIFNDILAHVDQIVDIRNKRAVQLPILKIIYTGLCSFDYSVILNSI PAAANLDALVDCENFFNYVQECPAIPIFNYIFTEKIYKSIFNVVDVGVDQ LSIELEGGKNQAELLQLAVKIINKVLDYQETYVEELFPIVKKHGKTDYFL PKNYSLHGLRSFYDAIFFNIPLVAHLGLYVGVDDQILATNSLRILAKLSE RSNGSVASLSKRNKLLTIFDSVDESARIKDAFITQLESSITDAGVLALKL ELLDFLTSNLSNYSRTMTISHLLLGFQVSNVISLGPNLATFISSGTSLLD SLISVLEASLNSITKDNIDYAPMRLATAALEIILKLCRNPLTSGLLYSYL IKENFFERIMILDPQVTRFTTWNGSPFDNSTEEKCKNFIESESVGAFLSF LAYRNYWTQYLGLFIHKISFSGTKSEVLTYVNYLISNTMYSVRLFSFLDP LNYGNICEPKETLSIFTNVPLNLEQVTLNKYCSGNIYDFHKMENLMRLIK RVRAESLHSNSFSLTVSKEQFLKDADVECIKAKSHFTNIISRNKALELNL SVLHSWVQLVQIIVTDGKLEPSTRSNFILEVFGTIIPKISDYIEFNITFS EELVSLAVFLFDIYNRDRKLITDKGTVDGRLYQLFKTCIQGINSPLSSVA LRSDFYILANHYLSRVLSDQVGSEKVLQDLRLGSKKLVEIIWNDVVYGEG TSRVTGILLLDSLIQLANRSKENFILDSLMKTTRLLLIIRSLKNTDALLN STTEHINIDDLLYELTAFKATVFFLIRVAETRGGASALIENNLFRIIAEL SFLKVDPDLGLDLMFDEVYVQNSKFLKVNVTLDNPLLVDKDANGVSLFEL IVPIFQLISAVLVSMGSSNKAVVQTVKGLLNTYKRLVIGIFKRDLLREKE DKKNSSDPNNQSLNEMVKLIVMLCTLTGYQNND*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP192/YJL039C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
NUP192 Kosova B, et al. (1999) Nup192p is a conserved nucleoporin with a preferential location at the inner site of the nuclear membrane. J Biol Chem 274(32):22646-51

Standard Name	Reference
NUP192	*Kosova B, et al.* (1999)** Nup192p is a conserved nucleoporin with a preferential location at the inner site of the nuclear membrane. J Biol Chem 274(32):22646-51

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YJL039C SGD Systematic Sequence

853410 NCBI: Gene ID

NP_012495.1 NCBI: RefSeq protein version ID

NP_012495.1 NCBI: RefSeq protein version ID

6322421 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YJL039C	SGD Systematic Sequence
853410	NCBI: Gene ID
NP_012495.1	NCBI: RefSeq protein version ID
NP_012495.1	NCBI: RefSeq protein version ID
6322421	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
19 curated references; 0 references not yet curated
Protein-protein Interactions
Luo Y, et al. (2010) Resolving the Composition of Protein Complexes Using a MALDI LTQ Orbitrap. J Am Soc Mass Spectrom 21(1):34-46
       |APL1 |APL3 |APM4 |APS2 |ASM4 |BMH2 |EDE1 |FKS1 |NIC96 |NSP1 |NUP120 |NUP133 |NUP145 |NUP159 |MORE
RNA Levels and Processing
Chen AK, et al. (2009) Response of Saccharomyces cerevisiae to stress-free acidification. J Microbiol 47(1):1-8
       |ACE2 |ACO1 |ARN1 |ARN2 |ARP4 |ATP1 |ATP16 |ATP2 |ATP3 |BRF1 |CAP1 |CAP2 |CBF5 |CCC2 |MORE
Evolution
Non-Fungal Related Genes/Proteins
DeGrasse JA, et al. (2009) Evidence for a shared nuclear pore complex architecture that is conserved from the last common eukaryotic ancestor. Mol Cell Proteomics 8(9):2119-30
       |MLP1 |MLP2 |NIC96 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP82 |NUP84 |NUP85
Other Features
Protein/Nucleic Acid Structure
Lezon TR, et al. (2009) Global motions of the nuclear pore complex: insights from elastic network models. PLoS Comput Biol 5(9):e1000496
         |NUP120 |NUP145 |NUP157 |NUP170 |NUP84 |NUP85 |SEC13 |SEH1
Cellular Location
Computational analysis
Protein Physical Properties
Protein-protein Interactions
Protein/Nucleic Acid Structure
Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94
           |ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Cellular Location
Evolution
Protein/Nucleic Acid Structure
Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701
           |ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Protein-protein Interactions
Techniques and Reagents
Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6
       |ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Cellular Location
Function/Process
Protein Sequence Features
Protein-protein Interactions
Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96
         |GLE1 |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP157 |NUP159 |NUP170 |NUP2 |MORE
Reviews
Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310
       |ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Evolution
Fungal Related Genes/Proteins
De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81
       |AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Protein/Nucleic Acid Structure
Strains/Constructs
Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7
       |ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |MORE
Reviews
Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82
       |ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52
           |ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
Protein Physical Properties
Protein Sequence Features
Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5
         |ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |MORE
Reviews
Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75
       |ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Gomez-Ospina N, et al. (2000) Yeast nuclear pore complex assembly defects determined by nuclear envelope reconstruction. J Struct Biol 132(1):1-5
       |NIC96
Cellular Location
Protein Physical Properties
Strains/Constructs
Techniques and Reagents
Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51
       |AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Cellular Location
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Strains/Constructs
Kosova B, et al. (1999) Nup192p is a conserved nucleoporin with a preferential location at the inner site of the nuclear membrane. J Biol Chem 274(32):22646-51
       |NIC96 |NUP49
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Grandi P, et al. (1997) Nup93, a vertebrate homologue of yeast Nic96p, forms a complex with a novel 205-kDa protein and is required for correct nuclear pore assembly. Mol Biol Cell 8(10):2017-38
       |NIC96 |NSP1

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.