MAD2/YJL030W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrX: 387651 to 388241
CDS: 387651 - 388241

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

MAD2 YJL030W ORF, Verified S000003567

Description
Component of the spindle-assembly checkpoint complex, which delays the onset of anaphase in cells with defects in mitotic spindle assembly; forms a complex with Mad1p

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-12-05 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0131
Assigned on 2007-05-23 UniProtKB
cell division GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0132
Assigned on 2007-05-23 UniProtKB
chromosome decondensation Vas AC, et al. (2007) In vivo analysis of chromosome condensation in Saccharomyces cerevisiae. Mol Biol Cell 18(2):557-68
       IMP : Inferred from Mutant Phenotype
Assigned on 2006-12-15 SGD
mitosis DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003511
Assigned on 2008-02-13 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0498
Assigned on 2007-05-23 UniProtKB
mitotic cell cycle Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
mitotic cell cycle spindle assembly checkpoint Hardwick KG, et al. (2000) MAD3 encodes a novel component of the spindle checkpoint which interacts with Bub3p, Cdc20p, and Mad2p. J Cell Biol 148(5):871-82
       IMP : Inferred from Mutant Phenotype
IGI : Inferred from Genetic Interaction
Assigned on 2001-01-18 SGD
protein complex assembly Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
colocalizes_with condensed nuclear chromosome kinetochore Iouk T, et al. (2002) The yeast nuclear pore complex functionally interacts with components of the spindle assembly checkpoint. J Cell Biol 159(5):807-19
       IDA : Inferred from Direct Assay
Assigned on 2007-08-03 SGD
mitotic checkpoint complex Hardwick KG, et al. (2000) MAD3 encodes a novel component of the spindle checkpoint which interacts with Bub3p, Cdc20p, and Mad2p. J Cell Biol 148(5):871-82
       IPI : Inferred from Physical Interaction with SGD:MAD3, SGD:CDC20
Assigned on 2007-10-01 SGD
Fraschini R, et al. (2001) Bub3 interaction with Mad2, Mad3 and Cdc20 is mediated by WD40 repeats and does not require intact kinetochores. EMBO J 20(23):6648-59
       IPI : Inferred from Physical Interaction with SGD:BUB3, SGD:CDC20
IDA : Inferred from Direct Assay
Assigned on 2007-10-01 SGD
nuclear pore Iouk T, et al. (2002) The yeast nuclear pore complex functionally interacts with components of the spindle assembly checkpoint. J Cell Biol 159(5):807-19
       IDA : Inferred from Direct Assay
Assigned on 2003-02-03 SGD
nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0539
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0191
Assigned on 2008-02-13 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
SUMMARY PARAGRAPH for MAD2/YJL030W for MAD2
MAD2 is a non-essential gene that encodes a component of the spindle checkpoint (1, 2). The spindle checkpoint delays the onset of anaphase in cells with defects in mitotic spindle assembly or in the attachment of chromosomes to the spindle microtubules (see 3 for review; reference 4 describes defects detected by the checkpoint). The checkpoint works by inhibiting the activity of the anaphase promoting complex, thereby preventing the degradation of several cell cycle regulators (3). Like other spindle checkpoint mutants, mad2 loss-of-function mutants are sensitive to benomyl and cannot delay cell division in response to spindle depolymerization (1). Mad2p forms a tight complex with another spindle checkpoint protein, Mad1p, throughout the cell cycle (5). Mad2p also forms a complex with Cdc20p, which activates the anaphase promoting complex, and Mad3p; the presence of Mad1p is required for the complex to form (6). Bub1p, Bub3p, Mad1p, Mad2p, Mad3p, and the protein kinase Mps1p act in a branch of the spindle checkpoint pathway that may prevent premature chromosome disjunction. A second branch involves Bub2p and Bfa1p, and may prevent cytokinesis prior to chromosome segregation (7, 8, 9, 10). Homologs of Mad2p act in the spindle checkpoint in Xenopus (Xmad2; 11, 12) and human (MAD2L1 and MAD2L2; 13, 14). MAD2 was originally identified as the open reading frame YJL031C (see 15 and erratum in Nature (1994) 371(6496):438). However, it is now known that MAD2 corresponds to the adjacent open reading frame YJL030W, while YJL031C encodes the geranylgeranyltransferase subunit Bet4p.
Last Updated: 2005-07-01

Basic References [TOP]
BASIC INFORMATION REFERENCES forMAD2/YJL030W for MAD2
1) Li R and Murray AW (1991) Feedback control of mitosis in budding yeast. Cell 66(3):519-31

2) Hardwick KG and Murray AW (1995) Mad1p, a phosphoprotein component of the spindle assembly checkpoint in budding yeast. J Cell Biol 131(3):709-20

3) Hardwick KG (1998) The spindle checkpoint. Trends Genet 14(1):1-4

4) Hardwick KG, et al. (1999) Lesions in many different spindle components activate the spindle checkpoint in the budding yeast Saccharomyces cerevisiae. Genetics 152(2):509-18

5) Chen RH, et al. (1999) The spindle checkpoint of budding yeast depends on a tight complex between the Mad1 and Mad2 proteins. Mol Biol Cell 10(8):2607-18

6) Hwang LH, et al. (1998) Budding yeast Cdc20: a target of the spindle checkpoint. Science 279(5353):1041-4

7) Alexandru G, et al. (1999) Sister chromatid separation and chromosome re-duplication are regulated by different mechanisms in response to spindle damage. EMBO J 18(10):2707-21

8) Fesquet D, et al. (1999) A Bub2p-dependent spindle checkpoint pathway regulates the Dbf2p kinase in budding yeast. EMBO J 18(9):2424-34

9) Fraschini R, et al. (1999) Budding yeast Bub2 is localized at spindle pole bodies and activates the mitotic checkpoint via a different pathway from Mad2. J Cell Biol 145(5):979-91

10) Li R (1999) Bifurcation of the mitotic checkpoint pathway in budding yeast. Proc Natl Acad Sci U S A 96(9):4989-94

11) Chen RH, et al. (1996) Association of spindle assembly checkpoint component XMAD2 with unattached kinetochores. Science 274(5285):242-6

12) Chen RH, et al. (1998) Spindle checkpoint protein Xmad1 recruits Xmad2 to unattached kinetochores. J Cell Biol 143(2):283-95

13) Li Y and Benezra R (1996) Identification of a human mitotic checkpoint gene: hsMAD2. Science 274(5285):246-8

14) Cahill DP, et al. (1999) Characterization of MAD2B and other mitotic spindle checkpoint genes. Genomics 58(2):181-7

15) Li R, et al. (1993) The mitotic feedback control gene MAD2 encodes the alpha-subunit of a prenyltransferase. Nature 366(6450):82-4

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for MAD2/YJL030W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for MAD2/YJL030W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSQSISL

C-term AQVSYKY

Length(aa) 196

MW(Da) 22,284

pI 5.15

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.030

Codon Adaptation Index 0.115

Frequency of Optimal Codons 0.406

Hydropathicity of Protein -0.355

Aromaticity Score 0.102

10 20 30 40 50 | | | | | MSQSISLKGSTRTVTEFFEYSINSILYQRGVYPAEDFVTVKKYDLTLLKT HDDELKDYIRKILLQVHRWLLGGKCNQLVLCIVDKDEGEVVERWSFNVQH ISGNSNGQDDVVDLNTTQSQIRALIRQITSSVTFLPELTKEGGYTFTVLA YTDADAKVPLEWADSNSKEIPDGEVVQFKTFSTNDHKVGAQVSYKY*

Protein Structures from PDB: proteins of known structure with sequence similarity to MAD2/YJL030W, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to MAD2 Homolog Source (per PDB) Protein Alignment: MAD2 vs. Homolog External Links
P-Value %Identical %Similar Alignment
2v64 ( Chain: E, H, D, F, A, C)
Crystallographic structure of the conformational dimer of the spindle assembly checkpoint protein mad2.
PDB_Info
PDB_Structure
Homo sapiens Chain E = 6.2e-33 44 32 View alignment SCOP
MMDB
CATH
Chain H = 6.2e-33 44 32 View alignment
Chain D = 6.2e-33 44 32 View alignment
Chain F = 1.5e-32 43 32 View alignment
Chain A = 1.5e-32 43 32 View alignment
Chain C = 1.5e-32 43 32 View alignment
2vfx ( Chain: D, L, H, A, B, C, K, E, F, G, I, J)
Structure of the symmetric mad2 dimer
PDB_Info
PDB_Structure
Homo sapiens Chain D = 1.8e-32 43 32 View alignment SCOP
MMDB
CATH
Chain L = 1.8e-32 43 32 View alignment
Chain H = 1.8e-32 43 32 View alignment
Chain A = 1.8e-32 43 32 View alignment
Chain B = 1.8e-32 43 32 View alignment
Chain C = 1.8e-32 43 32 View alignment
Chain K = 1.8e-32 43 32 View alignment
Chain E = 1.8e-32 43 32 View alignment
Chain F = 1.8e-32 43 32 View alignment
Chain G = 1.8e-32 43 32 View alignment
Chain I = 1.8e-32 43 32 View alignment
Chain J = 1.8e-32 43 32 View alignment
1klq ( Chain: A)
The mad2 spindle checkpoint protein undergoes similar major conformational changes upon binding to either mad1 or cdc20
PDB_Info
PDB_Structure
Homo sapiens 2.0e-32 43 32 View alignment SCOP
MMDB
CATH
2qyf ( Chain: C, A)
Crystal structure of the mad2/p31(comet)/mad2-binding peptide ternary complex
PDB_Info
PDB_Structure
Homo sapiens Chain C = 5.4e-32 43 31 View alignment SCOP
MMDB
CATH
Chain A = 5.4e-32 43 31 View alignment
1go4 ( Chain: C, D, B, A)
Crystal structure of mad1-mad2 reveals a conserved mad2 binding motif in mad1 and cdc20.
PDB_Info
PDB_Structure
Homo sapiens Chain C = 7.6e-32 43 31 View alignment SCOP
MMDB
CATH
Chain D = 7.6e-32 43 31 View alignment
Chain B = 7.6e-32 43 31 View alignment
Chain A = 7.6e-32 43 31 View alignment
1s2h ( Chain: A)
The mad2 spindle checkpoint protein possesses two distinct natively folded states
PDB_Info
PDB_Structure
Homo sapiens 7.7e-32 43 31 View alignment SCOP
MMDB
CATH
1duj ( Chain: A)
Solution structure of the spindle assembly checkpoint protein human mad2
PDB_Info
PDB_Structure
Homo sapiens 7.1e-31 43 31 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
MAD2 SGD (2007) Information without a citation in SGD

Nomenclature History Notes
Date Note
2002-07-16 The genetically-defined MAD2 gene was originally identified as YJL031C (see Li R, et al. (1993) Nature 366(6450):82-4, and erratum in Nature (1994) 371(6496):438). It is now known that MAD2, involved in the mitotic spindle checkpoint, is equivalent to YJL030W, while YJL031C/BET4 encodes the alpha subunit of geranylgeranyltransferase type II.

Standard Name	Reference
MAD2	SGD (2007) Information without a citation in SGD

Date	Note
2002-07-16	The genetically-defined MAD2 gene was originally identified as YJL031C (see Li R, et al. (1993) Nature 366(6450):82-4, and erratum in Nature (1994) 371(6496):438). It is now known that MAD2, involved in the mitotic spindle checkpoint, is equivalent to YJL030W, while YJL031C/BET4 encodes the alpha subunit of geranylgeranyltransferase type II.

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YJL030W SGD Systematic Sequence

853422 NCBI: Gene ID

NP_012504.1 NCBI: RefSeq protein version ID

NP_012504.1 NCBI: RefSeq protein version ID

6322430 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YJL030W	SGD Systematic Sequence
853422	NCBI: Gene ID
NP_012504.1	NCBI: RefSeq protein version ID
NP_012504.1	NCBI: RefSeq protein version ID
6322430	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
177 curated references; 0 references not yet curated
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Dotiwala F, et al. (2010) Mad2 Prolongs DNA Damage Checkpoint Arrest Caused by a Double-Strand Break via a Centromere-Dependent Mechanism. Curr Biol
       |BUB1 |BUB3 |CDC5 |CEN3 |CHK1 |DOT1 |HHT1 |HHT2 |MAD1 |MAD3 |PTC2 |PTC3 |RAD51 |RAD53 |MORE
Mutants/Phenotypes
Strains/Constructs
Schleker T, et al. (2010) Cell cycle-dependent phosphorylation of Rad53 kinase by Cdc5 and Cdc28 modulates checkpoint adaptation. Cell Cycle 9(2):350-63
       |CDC15 |CDC16 |CDC28 |CDC4 |CDC5 |CDC53 |CDC7 |MEC1 |RAD53 |SML1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Chiroli E, et al. (2009) Cdc14 inhibition by the spindle assembly checkpoint prevents unscheduled centrosome separation in budding yeast. Mol Biol Cell 20(10):2626-37
       |BUB3 |CDC14 |CDC16 |CDC20 |CIN8 |KIP1 |MAD3 |PDS1 |STU1
Reviews
De Wulf P, et al. (2009) Protein phosphatases take the mitotic stage. Curr Opin Cell Biol 21(6):806-15
     |BFA1 |BUB1 |CDC14 |CDC20 |CDC5 |CDC55 |FIN1 |GLC7 |IPL1 |KIN4 |MAD3 |MPS1 |NET1 |PDS1 |MORE
Computational analysis
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Doncic A, et al. (2009) Reverse engineering of the spindle assembly checkpoint. PLoS One 4(8):e6495
           |BUB1 |BUB3 |CDC20 |MAD1 |MAD3 |SGO1
Genetic Interactions
Mutants/Phenotypes
Enserink JM, et al. (2009) Cdc28/Cdk1 positively and negatively affects genome stability in S. cerevisiae. J Cell Biol 185(3):423-37
       |ASF1 |BUB2 |BUB3 |CDC28 |CSM3 |CTF18 |CTF4 |ELG1 |FAR1 |LCD1 |MEC1 |MRE11 |POL30 |POL32 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Feng W, et al. (2009) Centromere replication timing determines different forms of genomic instability in Saccharomyces cerevisiae checkpoint mutants during replication stress. Genetics 183(4):1249-60
     |CDC23 |CEN2 |CEN4 |IPL1 |MEC1 |RAD53 |SML1
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Reviews
Fuller BG and Stukenberg PT (2009) Cell division: righting the check. Curr Biol 19(14):R550-3
       |BUB1 |BUB3 |CDC20 |GLC7 |IPL1 |MAD1 |MAD3 |MPS1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Gomez-Gonzalez B, et al. (2009) The S-phase checkpoint is required to respond to R-loops accumulated in THO mutants. Mol Cell Biol 29(19):5203-13
       |CTF18 |DDC1 |ELG1 |HPR1 |MEC1 |MEC3 |MFT1 |MRC1 |PRI1 |RAD17 |RAD24 |RAD53 |RAD9
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Ikui AE and Cross FR (2009) Specific genetic interactions between spindle assembly checkpoint proteins and B-Type cyclins in Saccharomyces cerevisiae. Genetics 183(1):51-61
     |BIR1 |BUB1 |BUB3 |CDC10 |CLB3 |CLB4 |CLB5 |GRR1 |IPL1 |MCK1 |MYO1 |SGO1 |TUB1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Kemmler S, et al. (2009) Mimicking Ndc80 phosphorylation triggers spindle assembly checkpoint signalling. EMBO J 28(8):1099-110
       |BUB1 |IPL1 |MPS1 |TID3
Mutants/Phenotypes
Strains/Constructs
Kiermaier E, et al. (2009) A Dam1-based artificial kinetochore is sufficient to promote chromosome segregation in budding yeast. Nat Cell Biol 11(9):1109-15
       |ASK1 |CBF2 |CEP3 |CTF13 |DAD1 |DAM1 |IPL1 |SLI15 |SPC19 |TID3
Reviews
Lee MT and Bachant J (2009) SUMO Modification of DNA topoisomerase II: Trying to get a CENse of it all. DNA Repair (Amst) 8(4):557-68
       |BUB1 |IPL1 |NFI1 |SIZ1 |TOP1 |TOP2
Cellular Location
Non-Fungal Related Genes/Proteins
Pagliuca C, et al. (2009) Roles for the conserved spc105p/kre28p complex in kinetochore-microtubule binding and the spindle assembly checkpoint. PLoS One 4(10):e7640
             |BIK1 |BIM1 |BUB1 |CBF2 |CEP3 |CIN8 |CSE4 |DAM1 |KAR3 |KIP1 |KIP3 |MIF2 |MTW1 |OKP1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Park SY, et al. (2009) Bub2 regulation of cytokinesis and septation in budding yeast. BMC Cell Biol 10:43
       |BFA1 |BUB2 |TEM1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Ptak C, et al. (2009) A role for the karyopherin kap123p in microtubule stability. Traffic 10(11):1619-34
       |BIM1 |BNI1 |CAJ1 |KAP123 |KIP2 |KIP3 |TUB1 |TUB3
Protein Physical Properties
Protein-protein Interactions
Simonetta M, et al. (2009) The influence of catalysis on mad2 activation dynamics. PLoS Biol 7(1):e10
           |CDC20
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Amaro IA, et al. (2008) The Saccharomyces cerevisiae Homolog of p24 Is Essential for Maintaining the Association of p150Glued With the Dynactin Complex. Genetics 178(2):703-9
       |AIM4 |APQ12 |ARP1 |ARP10 |ASE1 |BIK1 |BIM1 |BNI1 |BUB1 |BUB3 |CHL4 |CIN1 |CIN2 |CTF18 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Grandin N and Charbonneau M (2008) Budding yeast 14-3-3 proteins contribute to the robustness of the DNA damage and spindle checkpoints. Cell Cycle 7(17):2749-61
       |BMH1 |BMH2 |BUB2 |CDC13 |CHK1 |CLB2 |EXO1 |MEC1 |MEC3 |RAD53 |RAD9 |RTG3 |TPK1
Cell Cycle Phase Involved
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Kim EM and Burke DJ (2008) DNA damage activates the SAC in an ATM/ATR-dependent manner, independently of the kinetochore. PLoS Genet 4(2):e1000015
           |BUB3 |CBF2 |CDC20 |CHK1 |MAD1 |MAD3 |MEC1 |PDS1 |RAD24 |RAD53 |RAD9 |SML1 |TEL1
Strains/Constructs
Leisner C, et al. (2008) Regulation of Mitotic Spindle Asymmetry by SUMO and the Spindle-Assembly Checkpoint in Yeast. Curr Biol 18(16):1249-55
       |CBF2 |KAR9 |NFI1 |NNF1 |SIZ1 |SMT3 |UBC9 |ULP1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Lyndaker AM, et al. (2008) Mutants Defective in Rad1-Rad10-Slx4 Exhibit a Unique Pattern of Viability During Mating-Type Switching in Saccharomyces cerevisiae. Genetics 179(4):1807-21
       |MMS2 |MPH1 |MSH2 |MSH3 |MUS81 |POL3 |RAD1 |RAD10 |RAD9 |SLX4
Cell Cycle Phase Involved
Mutants/Phenotypes
Regulation of
Strains/Constructs
Niu W, et al. (2008) Mechanisms of Cell Cycle Control Revealed by a Systematic and Quantitative Overexpression Screen in S. cerevisiae. PLoS Genet 4(7):e1000120
         |ACT1 |AIM20 |ALG6 |AME1 |ARC1 |ARF1 |ASK1 |ATG26 |AVO2 |BET4 |BUL1 |CBF1 |CDC31 |CDC39 |MORE
Genetic Interactions
Ohkuni K, et al. (2008) Ybp2 Associates with the Central Kinetochore of Saccharomyces cerevisiae and Mediates Proper Mitotic Progression. PLoS ONE 3(2):e1617
           |AME1 |BUB1 |BUB3 |CHL4 |CSE4 |CTF19 |CTF3 |CTF8 |MAD1 |MAD3 |MCM16 |MCM21 |MCM22 |NSL1 |MORE
Genetic Interactions
Park CJ, et al. (2008) Requirement for the budding yeast polo kinase cdc5 in proper microtubule growth and dynamics. Eukaryot Cell 7(3):444-53
     |CDC14 |CDC28 |CDC5 |NUD1 |SLK19 |STU2
Transcription
Ren Q, et al. (2008) Global transcriptional analysis of yeast cell death induced by mutation of sister chromatid cohesin. Comp Funct Genomics :634283
           |AEP1 |DMA2 |ELG1 |GCV1 |GLT1 |IBD2 |IRC3 |LCD1 |MAD3 |MCD1 |MEC3 |MPS1 |NTG1 |NTH2 |MORE
Reviews
Sczaniecka MM and Hardwick KG (2008) The spindle checkpoint: how do cells delay anaphase onset? SEB Exp Biol Ser 59:243-56
     |CDC20 |MAD3
Reviews
Wang Y (2008) Chromosome instability in yeast and its implications to the study of human cancer. Front Biosci 13:2091-102
       |AME1 |ASK1 |BIR1 |CBF2 |CDC20 |CDC28 |CDC5 |CDC55 |CEP3 |CLB1 |CLB2 |CLB3 |CLB4 |CLB5 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Alvaro D, et al. (2007) Genome-wide analysis of Rad52 foci reveals diverse mechanisms impacting recombination. PLoS Genet 3(12):e228
           |AHC1 |ATR1 |BCK1 |BDF1 |BDF2 |BUB2 |BUD27 |CBT1 |COX16 |CTF19 |CTF4 |DAK2 |DDC1 |DDR2 |MORE
Reviews
Banerjee S, et al. (2007) Suppression of gross chromosomal rearrangements by a new alternative replication factor C complex. Biochem Biophys Res Commun 362(3):546-9
       |ALO1 |ASF1 |BRE1 |BUB1 |BUB2 |BUB3 |CAC2 |CDC13 |CHK1 |CTF18 |DDC1 |DNL4 |DPB11 |DUN1 |MORE
Mutants/Phenotypes
Strains/Constructs
Boronat S and Campbell JL (2007) Mitotic Cdc6 stabilizes anaphase-promoting complex substrates by a partially Cdc28-independent mechanism, and this stabilization is suppressed by deletion of Cdc55. Mol Cell Biol 27(3):1158-71
             |BUB2 |CDC16 |CDC20 |CDC28 |CDC55 |CDC6 |CLB2 |CLB5 |MIH1 |PDS1 |RAD24 |SWE1 |TPD3
Genetic Interactions
Mutants/Phenotypes
Burton JL and Solomon MJ (2007) Mad3p, a pseudosubstrate inhibitor of APCCdc20 in the spindle assembly checkpoint. Genes Dev 21(6):655-67
       |BUB1 |CDC20 |HSL1 |MAD1 |MAD3 |PDS1
Strains/Constructs
Collins KA, et al. (2007) The Overexpression of a Saccharomyces cerevisiae Centromeric Histone H3 Variant Mutant Protein Leads to a Defect in Kinetochore Biorientation. Genetics 175(2):513-25
       |CEN8 |CSE4 |IPI1 |MTW1 |SPC29 |TUB1
Reviews
Diaz-Martinez LA and Yu H (2007) Running on a treadmill: dynamic inhibition of APC/C by the spindle checkpoint. Cell Div 2:23
       |BUB3 |CDC20 |MAD3
Protein-protein Interactions
King EM, et al. (2007) Mad3 KEN boxes mediate both Cdc20 and Mad3 turnover, and are critical for the spindle checkpoint. PLoS One 2(4):e342
           |CDC16 |CDC20 |CDH1 |MAD3
Function/Process
Mutants/Phenotypes
Strains/Constructs
Lacefield S and Murray AW (2007) The spindle checkpoint rescues the meiotic segregation of chromosomes whose crossovers are far from the centromere. Nat Genet 39(10):1273-7
       |SPO11
Genetic Interactions
Mutants/Phenotypes
Lai MS, et al. (2007) Rmi1, a member of the Sgs1-Top3 complex in budding yeast, contributes to sister chromatid cohesion. EMBO Rep 8(7):685-90
     |RAD51 |RMI1 |SGS1 |SMC1 |TOP3
Disease Gene Related
Non-Fungal Related Genes/Proteins
Li L, et al. (2007) Hepatocellular carcinoma-associated gene 2 interacts with MAD2L2. Mol Cell Biochem 304(1-2):297-304

Genetic Interactions
McSherry TD, et al. (2007) Non-catalytic function for ATR in the checkpoint response. Cell Cycle 6(16):2019-30
       |BUB2 |CHK1 |LCD1 |MEC1 |RAD9
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Ogiwara H, et al. (2007) Actin-related protein Arp4 functions in kinetochore assembly. Nucleic Acids Res 35(9):3109-17
                 |ARP4 |CBF2 |CSE4 |CTF3 |ESA1 |INO80 |MCD1 |MIF2 |MTW1 |NUF2 |RAD9 |SWR1
Function/Process
Shimada K and Gasser SM (2007) The origin recognition complex functions in sister-chromatid cohesion in Saccharomyces cerevisiae. Cell 128(1):85-99
       |ECO1 |ORC2 |SMC1
Cell Cycle Phase Involved
Regulatory Role
Stoler S, et al. (2007) Scm3, an essential Saccharomyces cerevisiae centromere protein required for G2/M progression and Cse4 localization. Proc Natl Acad Sci U S A 104(25):10571-6
           |CSE4 |SCM3
Reviews
Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310
       |ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Vas AC, et al. (2007) In vivo analysis of chromosome condensation in Saccharomyces cerevisiae. Mol Biol Cell 18(2):557-68
       |IPL1
Genetic Interactions
Strains/Constructs
Xu H, et al. (2007) Genetic dissection of parallel sister-chromatid cohesion pathways. Genetics 176(3):1417-29
             |CHL1 |CSM3 |CTF18 |CTF4 |CTF8 |DCC1 |MRC1 |PDS1 |RAD9 |TOF1
Genetic Interactions
Yong-Gonzalez V, et al. (2007) Condensin function at centromere chromatin facilitates proper kinetochore tension and ensures correct mitotic segregation of sister chromatids. Genes Cells 12(9):1075-90
           |AME1 |BUB1 |CBF2 |CDC15 |CHK1 |CLB2 |CSE4 |CTF3 |DAD1 |DSN1 |MAD1 |MAD3 |MCD1 |MIF2 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Andrews CA, et al. (2006) A mitotic topoisomerase II checkpoint in budding yeast is required for genome stability but acts independently of Pds1/securin. Genes Dev 20(9):1162-74
       |BUB2 |BUB3 |CDC14 |MEC1 |MIH1 |PDS1 |SWE1 |TOP2
Genetic Interactions
Strains/Constructs
Cuschieri L, et al. (2006) {gamma}-Tubulin Is Required for Proper Recruitment and Assembly of Kar9-Bim1 Complexes in Budding Yeast. Mol Biol Cell 17(10):4420-34
         |ARP1 |BIM1 |DYN1 |KAR9 |KIP2 |MYO2 |TUB1 |TUB4
Large-scale genetic interaction
Daniel JA, et al. (2006) Diverse functions of spindle assembly checkpoint genes in Saccharomyces cerevisiae. Genetics 172(1):53-65
       |ASE1 |BIM1 |BUB3 |CBF1 |CHL1 |CHL4 |CTF18 |CTF19 |CTF3 |CTF4 |CTF8 |GIM3 |GIM4 |HCM1 |MORE
Mutants/Phenotypes
Strains/Constructs
Lacefield S, et al. (2006) Consequences of defective tubulin folding on heterodimer levels, mitosis and spindle morphology in Saccharomyces cerevisiae. Genetics 173(2):635-46
       |BUB2 |CIN5 |PAC10 |PLP1 |TUB1 |TUB2 |TUB3
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Luke B, et al. (2006) The cullin Rtt101p promotes replication fork progression through damaged DNA and natural pause sites. Curr Biol 16(8):786-92
       |MEC1 |RAD51 |RAD52 |RAD53 |RAD55 |RRM3 |RTT101
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Protein Sequence Features
Protein/Nucleic Acid Structure
Strains/Constructs
Substrates/Ligands/Cofactors
Mapelli M, et al. (2006) Determinants of conformational dimerization of Mad2 and its inhibition by p31comet. EMBO J 25(6):1273-84
       |CDC20 |MAD1
Fungal Related Genes/Proteins
Protein Sequence Features
Meraldi P, et al. (2006) Phylogenetic and structural analysis of centromeric DNA and kinetochore proteins. Genome Biol 7(3):R23
       |AME1 |BUB1 |CBF2 |CEN1 |CEN10 |CEN11 |CEN12 |CEN13 |CEN14 |CEN15 |CEN16 |CEN2 |CEN3 |CEN4 |MORE
Cell Growth and Metabolism
Other Features
Protein Processing/Modification/Regulation
Moriya H, et al. (2006) In vivo robustness analysis of cell division cycle genes in Saccharomyces cerevisiae. PLoS Genet 2(7):e111
         |BUB2 |CDC14 |CDC15 |CDC20 |CDC28 |CDC6 |CDH1 |CLB1 |CLB2 |CLB3 |CLB4 |CLB5 |CLB6 |CLN1 |MORE
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Protein-protein Interactions
Protein/Nucleic Acid Structure
Strains/Constructs
Nezi L, et al. (2006) Accumulation of Mad2-Cdc20 complex during spindle checkpoint activation requires binding of open and closed conformers of Mad2 in Saccharomyces cerevisiae. J Cell Biol 174(1):39-51
       |CDC20 |MAD1
Genetic Interactions
Mutants/Phenotypes
Norden C, et al. (2006) The NoCut pathway links completion of cytokinesis to spindle midzone function to prevent chromosome breakage. Cell 125(1):85-98
       |ASE1 |BOI1 |BOI2 |CBF2 |CNM67 |IPL1 |MTW1 |NNF1 |SLI15 |TID3
Mutants/Phenotypes
Palframan WJ, et al. (2006) Anaphase inactivation of the spindle checkpoint. Science 313(5787):680-4
       |CDC15 |CDC20 |CDH1 |CLB2 |MAD1 |MPS1 |PDS1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Strawn LA and True HL (2006) Deletion of RNQ1 gene reveals novel functional relationship between divergently transcribed Bik1p/CLIP-170 and Sfi1p in spindle pole body separation. Curr Genet 50(6):347-66
       |BIK1 |CIK1 |CIN8 |KAR1 |KAR3 |KIP2 |PPH21 |RNQ1 |SFI1
Genetic Interactions
Mutants/Phenotypes
Yellman CM and Burke DJ (2006) The role of Cdc55 in the spindle checkpoint is through regulation of mitotic exit in Saccharomyces cerevisiae. Mol Biol Cell 17(2):658-66
       |BUB2 |CDC14 |CDC15 |CDC55 |CLB2 |LTE1 |PDS1 |SLK19 |SPO12
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Andrews CA, et al. (2005) Evidence that the yeast spindle assembly checkpoint has a target other than the anaphase promoting complex. Cell Cycle 4(11):1555-7
       |APC11 |APC2 |CDC20 |CDH1 |CLB5 |PDS1
Mutants/Phenotypes
Strains/Constructs
Cheslock PS, et al. (2005) The roles of MAD1, MAD2 and MAD3 in meiotic progression and the segregation of nonexchange chromosomes. Nat Genet 37(7):756-60
       |MAD1 |MAD3
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Corda Y, et al. (2005) Inactivation of Ku-mediated end joining suppresses mec1Delta lethality by depleting the ribonucleotide reductase inhibitor Sml1 through a pathway controlled by Tel1 kinase and the Mre11 complex. Mol Cell Biol 25(23):10652-64
       |DUN1 |EXO1 |LIF1 |MEC1 |MRE11 |RAD52 |RAD53 |RAD9 |RIF2 |SML1 |TEL1 |YKU70 |YKU80
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Dorer RK, et al. (2005) A small-molecule inhibitor of Mps1 blocks the spindle-checkpoint response to a lack of tension on mitotic chromosomes. Curr Biol 15(11):1070-6
       |BUB1 |BUB2 |BUB3 |CDC6 |CIN8 |CTF19 |IPL1 |KAR3 |MAD1 |MAD3 |MCM16 |MCM21 |MPS1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Indjeian VB, et al. (2005) The centromeric protein Sgo1 is required to sense lack of tension on mitotic chromosomes. Science 307(5706):130-3
       |BUB1 |BUB3 |CDC28 |MCD1 |MPS1 |PDS1 |SGO1
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Reviews
Kadura S and Sazer S (2005) SAC-ing mitotic errors: how the spindle assembly checkpoint (SAC) plays defense against chromosome mis-segregation. Cell Motil Cytoskeleton 61(3):145-60
       |BUB1 |BUB2 |BUB3 |CDC20 |CDH1 |CLB2 |DSN1 |ESP1 |IPL1 |MAD1 |MAD3 |MPS1 |MTW1 |NSL1 |MORE
Reviews
Kline-Smith SL, et al. (2005) Kinetochore-spindle microtubule interactions during mitosis. Curr Opin Cell Biol 17(1):35-46
       |DAM1 |IPL1 |MAD1 |MTW1 |NUF2 |SPC24 |SPC25 |STU2 |TID3
Reviews
Lacefield S and Murray A (2005) A delay like no other. Nat Genet 37(7):662-3
       |MAD1 |MAD3
Function/Process
Protein Physical Properties
Protein Sequence Features
Regulatory Role
Reviews
Nasmyth K (2005) How do so few control so many? Cell 120(6):739-46
             |CDC20 |MAD1 |PDS1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Pathak R, et al. (2005) A role for KEM1 at the START of the cell cycle in Saccharomyces cerevisiae. Curr Genet 48(5):300-9
           |BCK2 |BUB2 |CLN3 |KEM1 |MAD3 |SWI4
Cell Cycle Phase Involved
Protein Physical Properties
Protein-protein Interactions
Poddar A, et al. (2005) Two complexes of spindle checkpoint proteins containing Cdc20 and Mad2 assemble during mitosis independently of the kinetochore in Saccharomyces cerevisiae. Eukaryot Cell 4(5):867-78
       |BUB3 |CDC20 |CDC27 |MAD3
Cellular Location
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Quimby BB, et al. (2005) Ran GTPase regulates Mad2 localization to the nuclear pore complex. Eukaryot Cell 4(2):274-80
       |GSP1 |MAD1 |NTF2 |PDS1 |RNA1
Mutants/Phenotypes
Strains/Constructs
Rancati G, et al. (2005) Mad3/BubR1 phosphorylation during spindle checkpoint activation depends on both Polo and Aurora kinases in budding yeast. Cell Cycle 4(7):972-80
       |BUB1 |BUB2 |BUB3 |CBF2 |CDC26 |CDC5 |CLB1 |CLB2 |CLB3 |CLB4 |CLB5 |CLB6 |IPL1 |MAD1 |MORE
Genetic Interactions
Mutants/Phenotypes
Bogomolnaya LM, et al. (2004) Hym1p affects cell cycle progression in Saccharomyces cerevisiae. Curr Genet 46(4):183-92
       |ACE2 |BUB2 |CLN3 |HYM1 |MAD3 |NOP56
Cell Cycle Phase Involved
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Clerici M, et al. (2004) A Tel1/MRX-dependent checkpoint inhibits the metaphase-to-anaphase transition after UV irradiation in the absence of Mec1. Mol Cell Biol 24(23):10126-44
       |CDC28 |CHK1 |CLB2 |MEC1 |MRE11 |PDS1 |RAD14 |RAD53 |RAD9 |RFA1 |SML1 |TEL1
Cellular Location
Function/Process
Non-Fungal Related Genes/Proteins
Gillett ES, et al. (2004) Spindle checkpoint proteins and chromosome-microtubule attachment in budding yeast. J Cell Biol 164(4):535-46
       |BUB1 |BUB2 |BUB3 |IPL1 |MAD1 |MAD3 |STU2
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Ionescu CN, et al. (2004) The yeast rRNA biosynthesis factor Ebp2p is also required for efficient nuclear division. Yeast 21(14):1219-32
         |EBP2
Cell Cycle Phase Involved
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Katis VL, et al. (2004) Maintenance of cohesin at centromeres after meiosis I in budding yeast requires a kinetochore-associated protein related to MEI-S332. Curr Biol 14(7):560-72
       |BUB1 |MAM1 |REC8 |SGO1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Krishnan V, et al. (2004) DNA replication checkpoint prevents precocious chromosome segregation by regulating spindle behavior. Mol Cell 16(5):687-700
             |CIN8 |KIP3 |MEC1 |RAD53 |STU2
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Lee MS and Spencer FA (2004) Bipolar orientation of chromosomes in Saccharomyces cerevisiae is monitored by Mad1 and Mad2, but not by Mad3. Proc Natl Acad Sci U S A 101(29):10655-60
       |BIM1 |CDC6 |CHL4 |CIN1 |CIN2 |CIN8 |CTF19 |CTF3 |GIM4 |IML3 |KAR3 |MAD1 |MAD3 |MCM16 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Melloy PG and Holloway SL (2004) Changes in the localization of the Saccharomyces cerevisiae anaphase-promoting complex upon microtubule depolymerization and spindle checkpoint activation. Genetics 167(3):1079-94
       |CBF2 |CDC20 |CDC23 |OKP1 |SLK19 |SPC42
Non-Fungal Related Genes/Proteins
Meraldi P, et al. (2004) Timing and checkpoints in the regulation of mitotic progression. Dev Cell 7(1):45-60
           |BUB1
Function/Process
Protein-protein Interactions
Substrates/Ligands/Cofactors
Pan J and Chen RH (2004) Spindle checkpoint regulates Cdc20p stability in Saccharomyces cerevisiae. Genes Dev 18(12):1439-51
       |BUB1 |CDC20 |CDH1 |MAD3 |PDS1
Genetic Interactions
Strains/Constructs
Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9
           |ARV1 |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |BUD25 |CAX4 |CHO2 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |MORE
Function/Process
Poddar A, et al. (2004) Differential kinetochore requirements for establishment and maintenance of the spindle checkpoint are dependent on the mechanism of checkpoint activation in Saccharomyces cerevisiae. Cell Cycle 3(2):197-204
       |BUB2 |CBF2 |MPS1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Sarin S, et al. (2004) Uncovering novel cell cycle players through the inactivation of securin in budding yeast. Genetics 168(3):1763-71
         |APQ12 |CHL1 |CIK1 |CIN1 |CIN2 |CIN8 |CLB2 |CTF18 |CTF19 |CTF4 |DCC1 |DIA2 |ESP1 |GIM5 |MORE
Non-Fungal Related Genes/Proteins
Shah JV, et al. (2004) Dynamics of centromere and kinetochore proteins; implications for checkpoint signaling and silencing. Curr Biol 14(11):942-52
           |BUB1 |CDC20 |MAD1
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process
Aylon Y and Kupiec M (2003) The checkpoint protein Rad24 of Saccharomyces cerevisiae is involved in processing double-strand break ends and in recombination partner choice. Mol Cell Biol 23(18):6585-96
     |RAD24
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Chiroli E, et al. (2003) Budding yeast PAK kinases regulate mitotic exit by two different mechanisms. J Cell Biol 160(6):857-74
       |BUB2 |CDC14 |CDC15 |CDC20 |CDC28 |CLA4 |CLB2 |PDS1 |SIC1 |STE20 |SWE1 |TEM1
Non-Fungal Related Genes/Proteins
Chung E and Chen RH (2003) Phosphorylation of Cdc20 is required for its inhibition by the spindle checkpoint. Nat Cell Biol 5(8):748-53
       |BUB3 |CDC20 |MAD3
Function/Process
Kitazono AA, et al. (2003) Mutations in the yeast cyclin-dependent kinase Cdc28 reveal a role in the spindle assembly checkpoint. Mol Genet Genomics 269(5):672-84
     |BUB2 |CDC28
Function/Process
Genetic Interactions
Lai LA, et al. (2003) A novel yeast mutant that is defective in regulation of the Anaphase-Promoting Complex by the spindle damage checkpoint. Mol Genet Genomics 270(2):156-64
     |CDC16 |PDS1
Reviews
Lew DJ and Burke DJ (2003) The spindle assembly and spindle position checkpoints. Annu Rev Genet 37:251-82
         |AMA1 |APC1 |APC11 |APC2 |APC4 |APC5 |APC9 |BFA1 |BUB1 |BUB2 |BUB3 |CDC14 |CDC15 |CDC16 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Ross KE and Cohen-Fix O (2003) The role of Cdh1p in maintaining genomic stability in budding yeast. Genetics 165(2):489-503
       |CDC28 |CDH1 |PDS1 |SIC1 |SWE1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Abruzzi KC, et al. (2002) An alpha-tubulin mutant demonstrates distinguishable functions among the spindle assembly checkpoint genes in Saccharomyces cerevisiae. Genetics 161(3):983-94
       |BUB1 |BUB3 |MAD1 |MAD3 |MPS1 |TUB1
Non-Fungal Related Genes/Proteins
Chen RH (2002) BubR1 is essential for kinetochore localization of other spindle checkpoint proteins and its phosphorylation requires Mad1. J Cell Biol 158(3):487-96
       |BUB1 |BUB3 |CDC20 |MAD1
Non-Fungal Related Genes/Proteins
Fang G (2002) Checkpoint protein BubR1 acts synergistically with Mad2 to inhibit anaphase-promoting complex. Mol Biol Cell 13(3):755-66
       |BUB3 |CDC20 |MAD1
Cell Cycle Phase Involved
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Garber PM and Rine J (2002) Overlapping roles of the spindle assembly and DNA damage checkpoints in the cell-cycle response to altered chromosomes in Saccharomyces cerevisiae. Genetics 161(2):521-34
       |MAD1 |MCM2 |MCM3 |MEC1 |ORC2 |POL1 |RAD24 |RAD9
Mutants/Phenotypes
Strains/Constructs
Hu F and Elledge SJ (2002) Bub2 is a cell cycle regulated phospho-protein controlled by multiple checkpoints. Cell Cycle 1(5):351-5
       |BUB2 |CDC5 |MPS1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Hwang HS and Song K (2002) IBD2 encodes a novel component of the Bub2p-dependent spindle checkpoint in the budding yeast Saccharomyces cerevisiae. Genetics 161(2):595-609
       |BFA1 |BUB2 |CDC5 |CLB2 |DYN1 |IBD2 |MPS1 |PDS1
Cell Cycle Phase Involved
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Iouk T, et al. (2002) The yeast nuclear pore complex functionally interacts with components of the spindle assembly checkpoint. J Cell Biol 159(5):807-19
       |ASM4 |MAD1 |NUP100 |NUP157 |NUP170 |NUP188 |NUP53 |POM152
Non-Fungal Related Genes/Proteins
Iwanaga Y, et al. (2002) Characterization of regions in hsMAD1 needed for binding hsMAD2. A polymorphic change in an hsMAD1 leucine zipper affects MAD1-MAD2 interaction and spindle checkpoint function. J Biol Chem 277(34):31005-13
         |MAD1
Non-Fungal Related Genes/Proteins
Kitagawa R, et al. (2002) The Cdc20 homolog, FZY-1, and its interacting protein, IFY-1, are required for proper chromosome segregation in Caenorhabditis elegans. Curr Biol 12(24):2118-23
         |APC4 |CDC20 |ESP1 |MAD1 |MCD1 |PDS1
Function/Process
Reviews
Krude T (2002) Chromatin assembly: the kinetochore connection. Curr Biol 12(7):R256-8
         |ASF1 |CAC2 |CSE4 |HIR1 |MSI1 |RLF2
Function/Process
Genetic Interactions
Maringele L and Lydall D (2002) EXO1-dependent single-stranded DNA at telomeres activates subsets of DNA damage and spindle checkpoint pathways in budding yeast yku70Delta mutants. Genes Dev 16(15):1919-33
       |BUB2 |CDC13 |CHK1 |DDC1 |DUN1 |EXO1 |MEC1 |MEC3 |MRE11 |RAD17 |RAD24 |RAD9 |YKU70 |YKU80
Non-Fungal Related Genes/Proteins
Millband DN and Hardwick KG (2002) Fission yeast Mad3p is required for Mad2p to inhibit the anaphase-promoting complex and localizes to kinetochores in a Bub1p-, Bub3p-, and Mph1p-dependent manner. Mol Cell Biol 22(8):2728-42
       |BUB1 |BUB3 |CDC20 |MAD1 |MAD3 |MPS1
Reviews
Musacchio A and Hardwick KG (2002) The spindle checkpoint: structural insights into dynamic signalling. Nat Rev Mol Cell Biol 3(10):731-41
       |CDC20
Disease Gene Related
Non-Fungal Related Genes/Proteins
Saeki A, et al. (2002) Frequent impairment of the spindle assembly checkpoint in hepatocellular carcinoma. Cancer 94(7):2047-54
       |BUB1 |BUB3 |CDC20
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Sharp JA, et al. (2002) Chromatin assembly factor I and Hir proteins contribute to building functional kinetochores in S. cerevisiae. Genes Dev 16(1):85-100
       |CAC2 |CBF2 |CEP3 |CSE4 |HIR1 |RLF2
Non-Fungal Related Genes/Proteins
Sironi L, et al. (2002) Crystal structure of the tetrameric Mad1-Mad2 core complex: implications of a 'safety belt' binding mechanism for the spindle checkpoint. EMBO J 21(10):2496-506
             |CDC20 |MAD1
Non-Fungal Related Genes/Proteins
Topper LM, et al. (2002) The dephosphorylated form of the anaphase-promoting complex protein Cdc27/Apc3 concentrates on kinetochores and chromosome arms in mitosis. Cell Cycle 1(4):282-92
     |CDC20 |CDC27
Fungal Related Genes/Proteins
Vardy L, et al. (2002) The gamma-tubulin complex protein Alp4 provides a link between the metaphase checkpoint and cytokinesis in fission yeast. Genes Cells 7(4):365-73
       |CDC15 |SPC97 |SPC98
Function/Process
Mutants/Phenotypes
Strains/Constructs
Yoshida S, et al. (2002) Mitotic exit network controls the localization of Cdc14 to the spindle pole body in Saccharomyces cerevisiae. Curr Biol 12(11):944-50
       |BUB2 |CDC14 |CDC15 |CDC5 |DBF2 |NUD1 |TEM1
Non-Fungal Related Genes/Proteins
Yu H (2002) Regulation of APC-Cdc20 by the spindle checkpoint. Curr Opin Cell Biol 14(6):706-14
       |BUB3 |CDC20 |MAD3
Mutants/Phenotypes
Other Features
Strains/Constructs
Zang Y, et al. (2002) Chromosome V loss due to centromere knockout or MAD2-deletion is immediately followed by restitution of homozygous diploidy in Saccharomyces cerevisiae. Yeast 19(6):553-64

Non-Fungal Related Genes/Proteins
Abrieu A, et al. (2001) Mps1 is a kinetochore-associated kinase essential for the vertebrate mitotic checkpoint. Cell 106(1):83-93
       |MAD1 |MPS1
Non-Fungal Related Genes/Proteins
Chen J and Fang G (2001) MAD2B is an inhibitor of the anaphase-promoting complex. Genes Dev 15(14):1765-70
       |CDC20 |CDH1 |MAD1
Cell Cycle Phase Involved
Cellular Location
Function/Process
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Fraschini R, et al. (2001) Bub3 interaction with Mad2, Mad3 and Cdc20 is mediated by WD40 repeats and does not require intact kinetochores. EMBO J 20(23):6648-59
       |BUB1 |BUB3 |CDC20 |MAD1 |MAD3 |MPS1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Fraschini R, et al. (2001) Role of the kinetochore protein Ndc10 in mitotic checkpoint activation in Saccharomyces cerevisiae. Mol Genet Genomics 266(1):115-25
     |BFA1 |BUB1 |BUB2 |BUB3 |CBF2 |ESP1 |MAD1 |PDS1
Reviews
Gillett ES and Sorger PK (2001) Tracing the pathway of spindle assembly checkpoint signaling. Dev Cell 1(2):162-4
     |CDC20
Disease Gene Related
Non-Fungal Related Genes/Proteins
Hernando E, et al. (2001) Molecular analyses of the mitotic checkpoint components hsMAD2, hBUB1 and hBUB3 in human cancer. Int J Cancer 95(4):223-7
       |BUB1 |BUB3
Non-Fungal Related Genes/Proteins
Hoffman DB, et al. (2001) Microtubule-dependent changes in assembly of microtubule motor proteins and mitotic spindle checkpoint proteins at PtK1 kinetochores. Mol Biol Cell 12(7):1995-2009
       |BUB3
Reviews
Kitagawa K and Hieter P (2001) Evolutionary conservation between budding yeast and human kinetochores. Nat Rev Mol Cell Biol 2(9):678-87
       |BIK1 |BUB1 |BUB3 |CBF1 |CBF2 |CEN1 |CEN10 |CEN11 |CEN12 |CEN13 |CEN14 |CEN15 |CEN16 |CEN2 |MORE
Function/Process
Nabetani A, et al. (2001) A conserved protein, Nuf2, is implicated in connecting the centromere to the spindle during chromosome segregation: a link between the kinetochore function and the spindle checkpoint. Chromosoma 110(5):322-34
       |NUF2
Non-Fungal Related Genes/Proteins
Pfleger CM, et al. (2001) Inhibition of Cdh1-APC by the MAD2-related protein MAD2L2: a novel mechanism for regulating Cdh1. Genes Dev 15(14):1759-64
       |CDC20 |CDH1
Non-Fungal Related Genes/Proteins
Reimann JD, et al. (2001) Emi1 regulates the anaphase-promoting complex by a different mechanism than Mad2 proteins. Genes Dev 15(24):3278-85
       |CDC20 |CDH1 |EMI1 |MAD1
Non-Fungal Related Genes/Proteins
Sharp-Baker H and Chen RH (2001) Spindle checkpoint protein Bub1 is required for kinetochore localization of Mad1, Mad2, Bub3, and CENP-E, independently of its kinase activity. J Cell Biol 153(6):1239-50
       |BUB1 |BUB3 |MAD1
Non-Fungal Related Genes/Proteins
Sironi L, et al. (2001) Mad2 binding to Mad1 and Cdc20, rather than oligomerization, is required for the spindle checkpoint. EMBO J 20(22):6371-82
       |CDC20 |MAD1
Mutants/Phenotypes
Strains/Constructs
Stern BM and Murray AW (2001) Lack of tension at kinetochores activates the spindle checkpoint in budding yeast. Curr Biol 11(18):1462-7
       |CDC6
Non-Fungal Related Genes/Proteins
Sudakin V, et al. (2001) Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2. J Cell Biol 154(5):925-36
       |BUB3 |CDC20
Non-Fungal Related Genes/Proteins
Tang Z, et al. (2001) Mad2-Independent inhibition of APCCdc20 by the mitotic checkpoint protein BubR1. Dev Cell 1(2):227-37
         |BUB3 |CDC20
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2001) Systematic genetic analysis with ordered arrays of yeast deletion mutants. Science 294(5550):2364-8
           |ARC18 |ARC40 |ARP1 |ARP2 |ARP6 |ASE1 |ASF1 |ATS1 |BBC1 |BCK1 |BEM1 |BEM2 |BEM4 |BFA1 |MORE
Non-Fungal Related Genes/Proteins
Zhang Y and Lees E (2001) Identification of an overlapping binding domain on Cdc20 for Mad2 and anaphase-promoting complex: model for spindle checkpoint regulation. Mol Cell Biol 21(15):5190-9
       |CDC20
Cell Cycle Phase Involved
Cellular Location
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Brady DM and Hardwick KG (2000) Complex formation between Mad1p, Bub1p and Bub3p is crucial for spindle checkpoint function. Curr Biol 10(11):675-8
       |BUB1 |BUB2 |BUB3 |MAD1 |MAD3 |MPS1
Cell Cycle Phase Involved
Function/Process
Genetic Interactions
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Daum JR, et al. (2000) The spindle checkpoint of Saccharomyces cerevisiae responds to separable microtubule-dependent events. Curr Biol 10(21):1375-8
       |BUB2 |KAR9
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Hardwick KG, et al. (2000) MAD3 encodes a novel component of the spindle checkpoint which interacts with Bub3p, Cdc20p, and Mad2p. J Cell Biol 148(5):871-82
       |BUB1 |BUB2 |BUB3 |CDC20 |CDC26 |CIN1 |MAD1 |MAD3 |MPS1
Function/Process
Krishnan R, et al. (2000) Saccharomyces cerevisiae BUB2 prevents mitotic exit in response to both spindle and kinetochore damage. Genetics 156(2):489-500
       |BUB2 |CDC3 |TEM1
Non-Fungal Related Genes/Proteins
Luo X, et al. (2000) Structure of the Mad2 spindle assembly checkpoint protein and its interaction with Cdc20. Nat Struct Biol 7(3):224-9
       |CDC20 |MAD1
Cell Cycle Phase Involved
Function/Process
Quimby BB, et al. (2000) The interaction between Ran and NTF2 is required for cell cycle progression. Mol Biol Cell 11(8):2617-29
       |GSP1 |NTF2
Cell Cycle Phase Involved
Function/Process
Mutants/Phenotypes
Strains/Constructs
Shonn MA, et al. (2000) Requirement of the spindle checkpoint for proper chromosome segregation in budding yeast meiosis. Science 289(5477):300-3
       |MAD1 |PDS1 |SPO11
Cell Cycle Phase Involved
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Regulation of
Regulatory Role
Strains/Constructs
Wang Y, et al. (2000) The Bfa1/Bub2 GAP complex comprises a universal checkpoint required to prevent mitotic exit. Curr Biol 10(21):1379-82
       |BFA1 |BUB2 |CDC13 |CDC14 |CDC28 |CDH1 |SIC1 |TEM1
Cell Cycle Phase Involved
Function/Process
Genetic Interactions
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Alexandru G, et al. (1999) Sister chromatid separation and chromosome re-duplication are regulated by different mechanisms in response to spindle damage. EMBO J 18(10):2707-21
       |BFA1 |BUB1 |BUB2 |CDC14 |CDC20 |CDC28 |CDH1 |CLB1 |CLB2 |CLB3 |CLB4 |MAD1 |MAD3 |MPS1 |MORE
Fungal Related Genes/Proteins
Beltraminelli N, et al. (1999) The S. pombe zfs1 gene is required to prevent septation if mitotic progression is inhibited. J Cell Sci 112 Pt 18:3103-14
       |BUB2 |MPS1
Disease Gene Related
Non-Fungal Related Genes/Proteins
Cahill DP, et al. (1999) Characterization of MAD2B and other mitotic spindle checkpoint genes. Genomics 58(2):181-7

Cell Cycle Phase Involved
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Regulation of
Strains/Constructs
Chen RH, et al. (1999) The spindle checkpoint of budding yeast depends on a tight complex between the Mad1 and Mad2 proteins. Mol Biol Cell 10(8):2607-18
       |BUB1 |BUB2 |BUB3 |CLB2 |MAD1 |MAD3
Cell Cycle Phase Involved
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Cohen-Fix O and Koshland D (1999) Pds1p of budding yeast has dual roles: inhibition of anaphase initiation and regulation of mitotic exit. Genes Dev 13(15):1950-9
       |CDC20 |CDH1 |CLB2 |PDS1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Fesquet D, et al. (1999) A Bub2p-dependent spindle checkpoint pathway regulates the Dbf2p kinase in budding yeast. EMBO J 18(9):2424-34
       |BUB1 |BUB2 |BUB3 |DBF2 |MAD1 |MPS1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Fraschini R, et al. (1999) Budding yeast Bub2 is localized at spindle pole bodies and activates the mitotic checkpoint via a different pathway from Mad2. J Cell Biol 145(5):979-91
       |BUB1 |BUB2 |BUB3 |CDC20 |CDC26 |MAD1 |PDS1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Hardwick KG, et al. (1999) Lesions in many different spindle components activate the spindle checkpoint in the budding yeast Saccharomyces cerevisiae. Genetics 152(2):509-18
       |CDC13 |CDC15 |CDC16 |CDC20 |CDC23 |CIN8 |KAR3 |MAD1 |MAD3 |TUB2
Mutants/Phenotypes
Strains/Constructs
Hegemann JH, et al. (1999) A fast method to diagnose chromosome and plasmid loss in Saccharomyces cerevisiae strains. Yeast 15(10B):1009-19
       |ARP6 |ARP8 |CTF13 |CTI6 |ECM27 |HTZ1 |IML1 |IML3 |KAP104 |NMD5 |SET2 |UBP10 |VPS75
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Li R (1999) Bifurcation of the mitotic checkpoint pathway in budding yeast. Proc Natl Acad Sci U S A 96(9):4989-94
       |BFA1 |BUB1 |BUB2 |BUB3 |CLB2 |MAD1 |MAD3 |MPS1
Reviews
Taylor SS (1999) Chromosome segregation: dual control ensures fidelity. Curr Biol 9(15):R562-4
       |BUB1 |BUB2 |BUB3 |MAD1 |MPS1
Non-Fungal Related Genes/Proteins
Yu HG, et al. (1999) The maize homologue of the cell cycle checkpoint protein MAD2 reveals kinetochore substructure and contrasting mitotic and meiotic localization patterns. J Cell Biol 145(3):425-35

Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Reviews
Aravind L and Koonin EV (1998) The HORMA domain: a common structural denominator in mitotic checkpoints, chromosome synapsis and DNA repair. Trends Biochem Sci 23(8):284-6
               |HOP1 |REV7
Other Features
Elledge SJ (1998) Mitotic arrest: Mad2 prevents sleepy from waking up the APC. Science 279(5353):999-1000
       |CDC20 |CDC34 |PDS1
Non-Fungal Related Genes/Proteins
Fang G, et al. (1998) The checkpoint protein MAD2 and the mitotic regulator CDC20 form a ternary complex with the anaphase-promoting complex to control anaphase initiation. Genes Dev 12(12):1871-83
       |CDC20 |CDH1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Farr KA and Hoyt MA (1998) Bub1p kinase activates the Saccharomyces cerevisiae spindle assembly checkpoint. Mol Cell Biol 18(5):2738-47
       |BUB1 |BUB2 |BUB3 |CLB2 |MAD1 |MAD3 |MPS1
Non-Fungal Related Genes/Proteins
Gorbsky GJ, et al. (1998) Microinjection of antibody to Mad2 protein into mammalian cells in mitosis induces premature anaphase. J Cell Biol 141(5):1193-205

Reviews
Hardwick KG (1998) The spindle checkpoint. Trends Genet 14(1):1-4
       |BUB1 |BUB2 |BUB3 |MAD1 |MPS1
Cell Cycle Phase Involved
Function/Process
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Regulatory Role
Hwang LH, et al. (1998) Budding yeast Cdc20: a target of the spindle checkpoint. Science 279(5353):1041-4
       |CDC20 |CDH1 |MAD1 |MAD3
Non-Fungal Related Genes/Proteins
Kallio M, et al. (1998) Mammalian p55CDC mediates association of the spindle checkpoint protein Mad2 with the cyclosome/anaphase-promoting complex, and is involved in regulating anaphase onset and late mitotic events. J Cell Biol 141(6):1393-406
       |CDC16 |CDC20 |CDC27 |CDC34 |CDH1
Function/Process
Other Features
Tavormina PA and Burke DJ (1998) Cell cycle arrest in cdc20 mutants of Saccharomyces cerevisiae is independent of Ndc10p and kinetochore function but requires a subset of spindle checkpoint genes. Genetics 148(4):1701-13
       |BUB1 |BUB2 |BUB3 |CBF2 |CDC20 |MAD1
Other Features
Chen RH and Murray A (1997) Characterization of spindle assembly checkpoint in Xenopus egg extracts. Methods Enzymol 283:572-84

Non-Fungal Related Genes/Proteins
Reviews
Gorbsky GJ (1997) Cell cycle checkpoints: arresting progress in mitosis. Bioessays 19(3):193-7

Fungal Related Genes/Proteins
He X, et al. (1997) The Schizosaccharomyces pombe spindle checkpoint protein mad2p blocks anaphase and genetically interacts with the anaphase-promoting complex. Proc Natl Acad Sci U S A 94(15):7965-70

Non-Fungal Related Genes/Proteins
O'Neill TJ, et al. (1997) Interaction of MAD2 with the carboxyl terminus of the insulin receptor but not with the IGFIR. Evidence for release from the insulin receptor after activation. J Biol Chem 272(15):10035-40

Non-Fungal Related Genes/Proteins
Pangilinan F, et al. (1997) Mammalian BUB1 protein kinases: map positions and in vivo expression. Genomics 46(3):379-88
       |BUB1
Mutants/Phenotypes
Strains/Constructs
Paulovich AG, et al. (1997) RAD9, RAD17, and RAD24 are required for S phase regulation in Saccharomyces cerevisiae in response to DNA damage. Genetics 145(1):45-62
     |APN1 |DUN1 |MAD3 |MAG1 |MEC1 |MGT1 |MLH1 |MSH2 |PDS1 |PMS1 |POL30 |RAD1 |RAD14 |RAD16 |MORE
Reviews
Straight AF and Murray AW (1997) The spindle assembly checkpoint in budding yeast. Methods Enzymol 283():425-40
     |BUB1 |BUB2 |BUB3 |MAD1 |MPS1 |TUB1 |TUB2 |TUB3
Mutants/Phenotypes
Yang S, et al. (1997) A role for the actin cytoskeleton of Saccharomyces cerevisiae in bipolar bud-site selection. J Cell Biol 136(1):111-23
       |ABP1 |ACT1 |AXL1 |AXL2 |BUD4 |BUD8 |BUD9 |SAC6 |SLA1 |SLA2 |SPA2 |SRV2
Non-Fungal Related Genes/Proteins
Chen RH, et al. (1996) Association of spindle assembly checkpoint component XMAD2 with unattached kinetochores. Science 274(5285):242-6

Non-Fungal Related Genes/Proteins
Li Y and Benezra R (1996) Identification of a human mitotic checkpoint gene: hsMAD2. Science 274(5285):246-8
       |CBF1
Function/Process
Mutants/Phenotypes
Pangilinan F and Spencer F (1996) Abnormal kinetochore structure activates the spindle assembly checkpoint in budding yeast. Mol Biol Cell 7(8):1195-208
     |BUB1 |BUB2 |CTF13 |RAD9
Genetic Interactions
Guenette S, et al. (1995) Suppression of a conditional mutation in alpha-tubulin by overexpression of two checkpoint genes. J Cell Sci 108 ( Pt 3):1195-204
       |BUB1 |BUB3 |TUB1 |TUB3
Mutants/Phenotypes
Strains/Constructs
Hardwick KG and Murray AW (1995) Mad1p, a phosphoprotein component of the spindle assembly checkpoint in budding yeast. J Cell Biol 131(3):709-20
     |BUB1 |BUB2 |BUB3 |MAD1 |MAD3
Mutants/Phenotypes
Wang Y and Burke DJ (1995) Checkpoint genes required to delay cell division in response to nocodazole respond to impaired kinetochore function in the yeast Saccharomyces cerevisiae. Mol Cell Biol 15(12):6838-44
       |BUB1 |BUB2 |BUB3 |CTF13 |MAD1
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Li R and Murray AW (1991) Feedback control of mitosis in budding yeast. Cell 66(3):519-31
       |BET4 |MAD1 |MAD3

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.