---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

MPS3/YJL019W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrX: 402891 to 404939 CDS: 402891 - 404939 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
MPS3	YJL019W	NEP98, YJL018W	ORF, Verified	S000003556
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 2002-08-28. Gene name expires on 2003-08-28.
Description
Nuclear envelope protein required for SPB duplication and nuclear fusion; localizes to the SPB half bridge and at telomeres during meiosis; required with Ndj1p and Csm4p for meiotic bouquet formation and telomere-led rapid prophase movement

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By ATP binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0067 Assigned on 2007-05-23 UniProtKB molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2002-11-25 SGD nucleotide binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0547 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0131 Assigned on 2007-05-23 UniProtKB meiotic telomere clustering Conrad MN, et al. (2007) MPS3 mediates meiotic bouquet formation in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 104(21):8863-8        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction with SGD:REC8 Assigned on 2008-08-01 SGD microtubule organizing center organization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mitotic sister chromatid cohesion Antoniacci LM, et al. (2004) The spindle pole body assembly component mps3p/nep98p functions in sister chromatid cohesion. J Biol Chem 279(47):49542-50        IMP : Inferred from Mutant Phenotype Assigned on 2005-01-19 SGD nuclear migration during conjugation with cellular fusion Nishikawa S, et al. (2003) Nep98p is a component of the yeast spindle pole body and essential for nuclear division and fusion. J Biol Chem 278(11):9938-43        IMP : Inferred from Mutant Phenotype Assigned on 2003-03-25 SGD spindle pole body duplication in nuclear envelope Jaspersen SL, et al. (2002) Mps3p is a novel component of the yeast spindle pole body that interacts with the yeast centrin homologue Cdc31p. J Cell Biol 159(6):945-56        IMP : Inferred from Mutant Phenotype Assigned on 2002-12-28 SGD synapsis Conrad MN, et al. (2007) MPS3 mediates meiotic bouquet formation in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 104(21):8863-8        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction with SGD:NDJ1 Assigned on 2008-08-01 SGD telomere tethering at nuclear periphery Bupp JM, et al. (2007) Telomere anchoring at the nuclear periphery requires the budding yeast Sad1-UNC-84 domain protein Mps3. J Cell Biol 179(5):845-54        IMP : Inferred from Mutant Phenotype Assigned on 2008-04-14 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By cytoplasm GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0963 Assigned on 2009-11-20 UniProtKB cytoskeleton GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0206 Assigned on 2009-11-20 UniProtKB half bridge of spindle pole body Jaspersen SL, et al. (2002) Mps3p is a novel component of the yeast spindle pole body that interacts with the yeast centrin homologue Cdc31p. J Cell Biol 159(6):945-56        IDA : Inferred from Direct Assay Assigned on 2004-10-08 SGD integral to membrane Jaspersen SL, et al. (2002) Mps3p is a novel component of the yeast spindle pole body that interacts with the yeast centrin homologue Cdc31p. J Cell Biol 159(6):945-56        IDA : Inferred from Direct Assay Assigned on 2004-10-08 SGD Nishikawa S, et al. (2003) Nep98p is a component of the yeast spindle pole body and essential for nuclear division and fusion. J Biol Chem 278(11):9938-43        IDA : Inferred from Direct Assay Assigned on 2003-03-25 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9906 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB nuclear chromosome, telomeric region Conrad MN, et al. (2007) MPS3 mediates meiotic bouquet formation in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 104(21):8863-8        IDA : Inferred from Direct Assay Assigned on 2008-08-01 SGD nuclear envelope Conrad MN, et al. (2007) MPS3 mediates meiotic bouquet formation in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 104(21):8863-8        IDA : Inferred from Direct Assay Assigned on 2008-08-01 SGD nuclear periphery Bupp JM, et al. (2007) Telomere anchoring at the nuclear periphery requires the budding yeast Sad1-UNC-84 domain protein Mps3. J Cell Biol 179(5):845-54        IDA : Inferred from Direct Assay Assigned on 2008-04-14 SGD nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB spindle pole body GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0252 Assigned on 2009-05-06 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forMPS3/YJL019W for MPS3 1) Jaspersen SL, et al. (2002) Mps3p is a novel component of the yeast spindle pole body that interacts with the yeast centrin homologue Cdc31p. J Cell Biol 159(6):945-56        2) Nishikawa S, et al. (2003) Nep98p is a component of the yeast spindle pole body and essential for nuclear division and fusion. J Biol Chem 278(11):9938-43        3) Conrad MN, et al. (2008) Rapid telomere movement in meiotic prophase is promoted by NDJ1, MPS3, and CSM4 and is modulated by recombination. Cell 133(7):1175-87

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for MPS3/YJL019W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for MPS3/YJL019W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MNNSNEH C-term GQDELDQ Length(aa) 682 MW(Da) 79,174 pI 5 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.015   Codon Adaptation Index 0.126   Frequency of Optimal Codons 0.431   Hydropathicity of Protein -0.820   Aromaticity Score 0.103

10 20 30 40 50 | | | | | MNNSNEHRREEAGAANEQMPYNKAVKSAYADVLKDKMNREQEISLRAIKK GIYTDGGETDNYDMDKENDSAYEMFKKNLDFPLDQHNDDDDDDPYIEDNG QETDGYSDEDYTDEADKSFIEDSDSDSYDLESNSDFEENLESSGEAKKLK WRTYIFYGGLFFVFYFFGSFLMTTVKNNDLESHSSGATSSPGKSFSNLQK QVNHLYSELSKRDEKHSSELDKTVKIIVSQFEKNIKRLLPSNLVNFENDI NSLTKQVETISTSMSELQRRNHKFTVENVTQWQDQLVKQLDTHLPQEIPV VINNSSSLLIIPELHNYLSALISDVIESPGIGTAGSAESRWEYDLNRYVK EILSNELQYIDKDYFIQEMNRRLQSNKQEIWEEITNRLETQQQQQQQQVQ QDYSNVPQQYSSILMKRLIHQIYNSNQHQWEDDLDFATYVQGTKLLNHLT SPTWRQGSGVQPIELLTDSKQSSSTYWQCENEPGCSWAIRFKTPLYLTKI SYMHGRFTNNLHIMNSAPRLISLYVKLSQTKEIKALQTLANQYGFGQHHK RDRNYIKIAKFEYRLTDSRIRQQMYLPPWFIQLKPLVRSIVFQVDENYGN KKFISLRKFIINGVTPQDLQIIENNEFPVLLGDTPEYGVTQNTDEGKRKV LLSKPPYASSSTSTKFHPASNVPSFGQDELDQ*

Protein Structures from PDB: proteins of known structure with sequence similarity to MPS3/YJL019W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
MPS3	2002-12-23	Jaspersen SL, et al. (2002) Mps3p is a novel component of the yeast spindle pole body that interacts with the yeast centrin homologue Cdc31p. J Cell Biol 159(6):945-56

Alias Name(s)	Reference
NEP98	Nishikawa S, et al. (2003) Nep98p is a component of the yeast spindle pole body and essential for nuclear division and fusion. J Biol Chem 278(11):9938-43

Sequence Annotation Notes

Date

Note

2003-01-02

Due to the insertion of a single G nucleotide after the G at 404443 on chromosome 10, YJL018W and YJL019W have been merged into one single ORF - MPS3/YJL019W. Note that YJL018W and NEP98 are now aliases for this merged ORF. We thank Sue L. Jasperson and Mark Winey for reporting this sequence error to SGD. Old: 404401 CATATCTCTGAGGAAATTTATCATCAACGGAGTGACACCGCAG-ATTTGCAAATAATTGA 404459 ||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||| New: 404401 CATATCTCTGAGGAAATTTATCATCAACGGAGTGACACCGCAGGATTTGCAAATAATTGA 404460 Jaspersen SL, et al. (2002) Mps3p is a novel component of the yeast spindle pole body that interacts with the yeast centrin homologue Cdc31p. J Cell Biol 159(6):945-56        Kellis M, et al. (2003) Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54            Brachat S, et al. (2003) Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii. Genome Biol 4(7):R45

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YJL019W	SGD Systematic Sequence
853434	NCBI: Gene ID
NP_012515.2	NCBI: RefSeq protein version ID
NP_012515.2	NCBI: RefSeq protein version ID
27808709	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
28 curated references; 0 references not yet curated
Reviews	Oza P and Peterson CL (2010) Opening the DNA repair toolbox: localization of DNA double strand breaks to the nuclear periphery. Cell Cycle 9(1):43-9
Reviews	Buhler M and Gasser SM (2009) Silent chromatin at the middle and ends: lessons from yeasts. EMBO J	|ABF1 |CSE4 |ESC1 |RAP1 |SIR2 |SIR3 |SIR4 |YKU70 |YKU80
Reviews	Gartenberg MR (2009) Life on the edge: telomeres and persistent DNA breaks converge at the nuclear periphery. Genes Dev 23(9):1027-31
Cellular Location	Kalocsay M, et al. (2009) Chromosome-wide Rad51 spreading and SUMO-H2A.Z-dependent chromosome fixation in response to a persistent DNA double-strand break. Mol Cell 33(3):335-43	|HEH2 |HTZ1 |NIC96 |RAD24 |RAD51 |RAD53 |RAD9 |RFA1 |SWR1
Reviews	Koszul R and Kleckner N (2009) Dynamic chromosome movements during meiosis: a way to eliminate unwanted connections? Trends Cell Biol 19(12):716-724	|CSM4 |ESC1 |NDJ1 |SIR4
Reviews	Lim HH, et al. (2009) Regulation of centrosome separation in yeast and vertebrates: common threads. Trends Cell Biol 19(7):325-33	|ACM1 |ASE1 |BMH1 |BMH2 |CDC28 |CDC31 |CDC5 |CDH1 |CIN8 |CLB1 |CLB2 |CLB3 |CLB4 |KAR1 |MORE
Protein-protein Interactions	Onischenko E, et al. (2009) Role of the Ndc1 interaction network in yeast nuclear pore complex assembly and maintenance. J Cell Biol 185(3):475-91	|ASM4 |NDC1 |NPL3 |NUP133 |NUP157 |NUP170 |NUP188 |NUP2 |NUP53 |NUP82 |POM152 |POM34
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Oza P, et al. (2009) Mechanisms that regulate localization of a DNA double-strand break to the nuclear periphery. Genes Dev 23(8):912-27	|CDC13 |EST2 |RAD51 |RAD52
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-Nucleic Acid Interactions Protein-protein Interactions Strains/Constructs	Schober H, et al. (2009) Yeast telomerase and the SUN domain protein Mps3 anchor telomeres and repress subtelomeric recombination. Genes Dev 23(8):928-38	|EST1 |EST2 |TEL1 |TLC1 |YKU80
Reviews	Towbin BD, et al. (2009) The nuclear envelope--a scaffold for silencing? Curr Opin Genet Dev 19(2):180-6	|ESC1 |SIR4 |SRC1
Cellular Location Function/Process	Conrad MN, et al. (2008) Rapid telomere movement in meiotic prophase is promoted by NDJ1, MPS3, and CSM4 and is modulated by recombination. Cell 133(7):1175-87	|CSM4 |DMC1 |NDJ1 |NDT80 |REC8 |SPO11 |ZIP1
Cellular Location	Kosaka H, et al. (2008) Csm4-dependent telomere movement on nuclear envelope promotes meiotic recombination. PLoS Genet 4(9):e1000196	|CSM4 |DMC1 |MMS4 |MSH4 |NDJ1 |RAD50 |RAD51 |RAP1 |RED1 |SPO11 |ZIP1
Genetic Interactions Protein-protein Interactions	Makio T, et al. (2008) Identification and characterization of a Jem1p ortholog of Candida albicans: dissection of Jem1p functions in karyogamy and protein quality control in Saccharomyces cerevisiae. Genes Cells 13(10):1015-26	|JEM1 |KAR2 |SCJ1
Cellular Location Computational analysis	Qi Y, et al. (2008) Finding friends and enemies in an enemies-only network: A graph diffusion kernel for predicting novel genetic interactions and co-complex membership from yeast genetic interactions. Genome Res 18(12):1991-2004	|AAH1 |ADA2 |AGE1 |AGE2 |AIM29 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |ANP1 |ARL3 |ARP3 |ARP4 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Antoniacci LM, et al. (2007) The nuclear envelope and spindle pole body-associated Mps3 protein bind telomere regulators and function in telomere clustering. Cell Cycle 6(1):75-9	|ECO1 |EST1
Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Bupp JM, et al. (2007) Telomere anchoring at the nuclear periphery requires the budding yeast Sad1-UNC-84 domain protein Mps3. J Cell Biol 179(5):845-54	|SIR2 |SIR3 |SIR4
Cell Cycle Phase Involved Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Conrad MN, et al. (2007) MPS3 mediates meiotic bouquet formation in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 104(21):8863-8	|NDJ1 |REC8
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Antoniacci LM and Skibbens RV (2006) Sister-chromatid telomere cohesion is nonredundant and resists both spindle forces and telomere motility. Curr Biol 16(9):902-6	|ECO1 |MCD1 |TEL04L |TEL04R
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Araki Y, et al. (2006) The Saccharomyces cerevisiae spindle pole body (SPB) component Nbp1p is required for SPB membrane insertion and interacts with the integral membrane proteins Ndc1p and Mps2p. Mol Biol Cell 17(4):1959-70	|BBP1 |CDC31 |MPS1 |MPS2 |NBP1 |NDC1 |SPC110 |SPC42
Reviews	Crasta K and Surana U (2006) Disjunction of conjoined twins: Cdk1, Cdh1 and separation of centrosomes. Cell Div 1:12	|ASE1 |CDC28 |CDC31 |CDH1 |CIN8 |CLB1 |CLB2 |CLB3 |CMD1 |CNM67 |KAR1 |KIP1 |NUD1 |SFI1 |MORE
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions Strains/Constructs	Jaspersen SL, et al. (2006) The Sad1-UNC-84 homology domain in Mps3 interacts with Mps2 to connect the spindle pole body with the nuclear envelope. J Cell Biol 174(5):665-75	|CDC31 |MPS2 |NBP1
Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Antoniacci LM, et al. (2004) The spindle pole body assembly component mps3p/nep98p functions in sister chromatid cohesion. J Biol Chem 279(47):49542-50	|ECO1
Cellular Location	Sundin BA, et al. (2004) Localization of proteins that are coordinately expressed with Cln2 during the cell cycle. Yeast 21(9):793-800	|ALG14 |ASF2 |AXL2 |BNI4 |CSI2 |DPB2 |HSL1 |JEM1 |KCC4 |MCD1 |NBP1 |POL12 |POL30 |PRI2 |MORE
DNA/RNA Sequence Features	Brachat S, et al. (2003) Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii. Genome Biol 4(7):R45	|BBC1 |CMC4 |COA2 |NCS6 |PCC1 |PRM10 |PTK1 |SKG1 |SUS1 |SWH1 |TMA23 |VMA9 |YBL039W-B |YBL104C |MORE
DNA/RNA Sequence Features	Kellis M, et al. (2003) Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423(6937):241-54	|AAT2 |API2 |ASA1 |ASR1 |ATG4 |AUA1 |AVT5 |BLM10 |BUD19 |CAT5 |CBS1 |CIN8 |COG2 |COQ3 |MORE
Alias Cellular Location Function/Process Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs	Nishikawa S, et al. (2003) Nep98p is a component of the yeast spindle pole body and essential for nuclear division and fusion. J Biol Chem 278(11):9938-43	|JEM1
Cell Cycle Phase Involved Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs Substrates/Ligands/Cofactors	Jaspersen SL, et al. (2002) Mps3p is a novel component of the yeast spindle pole body that interacts with the yeast centrin homologue Cdc31p. J Cell Biol 159(6):945-56	|CDC31 |KAR1 |SPC42
Function/Process Mutants/Phenotypes Strains/Constructs	de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42	|AAD4 |AIM22 |ALG12 |ALK2 |ARE2 |ARG2 |ARP5 |ASI2 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |MORE

Return to SGD

Send a Message to the SGD Curators