SYS1/YJL004C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrX: 432193 to 431582
CDS: 432193 - 431582

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

SYS1 YJL004C ORF, Verified S000003541

Description
Integral membrane protein of the Golgi required for targeting of the Arf-like GTPase Arl3p to the Golgi; multicopy suppressor of ypt6 null mutation

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-10-01 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
Golgi to endosome transport Tsukada M and Gallwitz D (1996) Isolation and characterization of SYS genes from yeast, multicopy suppressors of the functional loss of the transport GTPase Ypt6p. J Cell Sci 109 ( Pt 10)():2471-81
       IGI : Inferred from Genetic Interaction
Assigned on 2002-10-01 SGD
Golgi to plasma membrane protein transport Liu YW, et al. (2006) Arl1p is involved in transport of the GPI-anchored protein Gas1p from the late Golgi to the plasma membrane. J Cell Sci 119(Pt 18):3845-55
       IMP : Inferred from Mutant Phenotype
Assigned on 2006-09-26 SGD
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
vesicle organization Votsmeier C and Gallwitz D (2001) An acidic sequence of a putative yeast Golgi membrane protein binds COPII and facilitates ER export. EMBO J 20(23):6742-50
         IPI : Inferred from Physical Interaction
Assigned on 2002-10-01 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
Golgi apparatus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0333
Assigned on 2008-02-14 UniProtKB
integral to Golgi membrane Votsmeier C and Gallwitz D (2001) An acidic sequence of a putative yeast Golgi membrane protein binds COPII and facilitates ER export. EMBO J 20(23):6742-50
         IDA : Inferred from Direct Assay
Assigned on 2002-10-01 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
trans-Golgi network Behnia R, et al. (2004) Targeting of the Arf-like GTPase Arl3p to the Golgi requires N-terminal acetylation and the membrane protein Sys1p. Nat Cell Biol 6(5):405-13
       IDA : Inferred from Direct Assay
Assigned on 2005-05-23 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forSYS1/YJL004C for SYS1
1) Tsukada M and Gallwitz D (1996) Isolation and characterization of SYS genes from yeast, multicopy suppressors of the functional loss of the transport GTPase Ypt6p. J Cell Sci 109 ( Pt 10)():2471-81

2) Votsmeier C and Gallwitz D (2001) An acidic sequence of a putative yeast Golgi membrane protein binds COPII and facilitates ER export. EMBO J 20(23):6742-50

3) Behnia R, et al. (2004) Targeting of the Arf-like GTPase Arl3p to the Golgi requires N-terminal acetylation and the membrane protein Sys1p. Nat Cell Biol 6(5):405-13

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SYS1/YJL004C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SYS1/YJL004C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MVSIRRY

C-term KDLESQI

Length(aa) 203

MW(Da) 23,715

pI 6.27

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.052

Codon Adaptation Index 0.095

Frequency of Optimal Codons 0.376

Hydropathicity of Protein 0.338

Aromaticity Score 0.158

10 20 30 40 50 | | | | | MVSIRRYLRVPNELKPSQIFKQDSLSPSKIGLQIVLLQIFYYTTAIVLFY CWAKLAGYDLNIKEWLFSWENIDFTNAYGLSISLLWLLDSLICVFFLTVI VGRSKLAWDFAITIHAINFIVVFLYTRKFPSFSWFFLQILSSLILIFLGT WTTRWRELRDTFFEGLVDPNEGEVGLVTPSQQHSNHSELEQSPIQLKDLE SQI*

Protein Structures from PDB: proteins of known structure with sequence similarity to SYS1/YJL004C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
SYS1 SGD (2007) Information without a citation in SGD

Standard Name	Reference
SYS1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YJL004C SGD Systematic Sequence

853453 NCBI: Gene ID

NP_012530.1 NCBI: RefSeq protein version ID

NP_012530.1 NCBI: RefSeq protein version ID

6322456 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YJL004C	SGD Systematic Sequence
853453	NCBI: Gene ID
NP_012530.1	NCBI: RefSeq protein version ID
NP_012530.1	NCBI: RefSeq protein version ID
6322456	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
22 curated references; 0 references not yet curated
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Curwin AJ, et al. (2009) Phospholipid Transfer Protein Sec14 Is Required for Trafficking from Endosomes and Regulates Distinct trans-Golgi Export Pathways. J Biol Chem 284(11):7364-75
       |ARL1 |ARL3 |BGL2 |BRE5 |CDH1 |CIS3 |CLN2 |CSR1 |CTS1 |ECM33 |EXG1 |GYP1 |HSP150 |KEX2 |MORE
Genetic Interactions
Kim JH, et al. (2009) The unfolded protein response is necessary but not sufficient to compensate for defects in disulfide isomerization. J Biol Chem 284(16):10400-8
         |ALG8 |APM3 |APS3 |ARL1 |AVL9 |CCZ1 |CDC50 |COG8 |EPS1 |ERV41 |ERV46 |EUG1 |FLD1 |GCS1 |MORE
Genetic Interactions
Mutants/Phenotypes
Gustavsson M, et al. (2008) Functional genomics of monensin sensitivity in yeast: implications for post-Golgi traffic and vacuolar H(+)-ATPase function. Mol Genet Genomics 280(3):233-48
       |AKR1 |APL2 |ARC18 |ARF1 |BRE5 |BTS1 |CCZ1 |CDC50 |CHC1 |COG8 |EAF1 |EOS1 |ERG28 |FAB1 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Liu YW, et al. (2006) Arl1p is involved in transport of the GPI-anchored protein Gas1p from the late Golgi to the plasma membrane. J Cell Sci 119(Pt 18):3845-55
       |ARF1 |ARL1 |ARL3 |GAS1 |GCS1 |IMH1 |YPT6
Cellular Location
Strains/Constructs
Losev E, et al. (2006) Golgi maturation visualized in living yeast. Nature 441(7096):1002-6
       |PRC1 |SEC7 |VRG4
Function/Process
Genetic Interactions
Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19
           |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Cellular Location
Function/Process
Non-Fungal Related Genes/Proteins
Regulation of
Strains/Constructs
Behnia R, et al. (2004) Targeting of the Arf-like GTPase Arl3p to the Golgi requires N-terminal acetylation and the membrane protein Sys1p. Nat Cell Biol 6(5):405-13
       |ARL1 |ARL3 |IMH1 |MAK3
Reviews
Bonifacino JS and Glick BS (2004) The mechanisms of vesicle budding and fusion. Cell 116(2):153-66
       |BET1 |EMP24 |EMP46 |EMP47 |ERV25 |ERV41 |GAP1 |SAR1 |SEC12 |SEC13 |SEC16 |SEC17 |SEC18 |SEC23 |MORE
Reviews
Graham TR (2004) Membrane targeting: getting Arl to the Golgi. Curr Biol 14(12):R483-5
       |ARL3
Non-Fungal Related Genes/Proteins
Reviews
Jackson CL (2004) N-terminal acetylation targets GTPases to membranes. Nat Cell Biol 6(5):379-80
       |ARL1 |ARL3
Cellular Location
Function/Process
Mutants/Phenotypes
Protein-protein Interactions
Regulatory Role
Strains/Constructs
Setty SR, et al. (2004) Golgi targeting of ARF-like GTPase Arl3p requires its Nalpha-acetylation and the integral membrane protein Sys1p. Nat Cell Biol 6(5):414-9
       |ARL3 |MAK10 |MAK3
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Miller EA, et al. (2003) Multiple cargo binding sites on the COPII subunit Sec24p ensure capture of diverse membrane proteins into transport vesicles. Cell 114(4):497-509
     |BET1 |BOS1 |EMP24 |EMP47 |ERP1 |ERP2 |GAP1 |PRM8 |SEC13 |SEC22 |SEC23 |SEC24 |SEC31 |SED5 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Avaro S, et al. (2002) Mutants defective in secretory/vacuolar pathways in the EUROFAN collection of yeast disruptants. Yeast 19(4):351-71
         |ALG12 |ALG9 |APM3 |ERV29 |GAS1 |MON2 |OST2 |OST4 |RCY1 |ROT2 |TLG2 |VAC7 |VAM6 |VPS53 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Bensen ES, et al. (2001) Ric1p and the Ypt6p GTPase function in a common pathway required for localization of trans-Golgi network membrane proteins. Mol Biol Cell 12(1):13-26
       |END3 |GOS1 |KEX2 |PEP1 |RIC1 |SED5 |SLY1 |YKT6 |YPT6
Function/Process
Mutants/Phenotypes
Strains/Constructs
Muren E, et al. (2001) Identification of yeast deletion strains that are hypersensitive to brefeldin A or monensin, two drugs that affect intracellular transport. Yeast 18(2):163-72
       |ALG12 |ALG9 |BRE1 |BRE2 |BRE4 |BRE5 |ENT4 |ERG4 |HOS2 |IRC20 |LEM3 |LSM1 |MON1 |MON2 |MORE
Cellular Location
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Protein/Nucleic Acid Structure
Strains/Constructs
Substrates/Ligands/Cofactors
Votsmeier C and Gallwitz D (2001) An acidic sequence of a putative yeast Golgi membrane protein binds COPII and facilitates ER export. EMBO J 20(23):6742-50
         |SEC23 |SEC24
Function/Process
Mutants/Phenotypes
Strains/Constructs
Wiederkehr A, et al. (2001) Identification and characterization of Saccharomyces cerevisiae mutants defective in fluid-phase endocytosis. Yeast 18(8):759-73
     |BRE4 |COS10 |EDE1 |EHD3 |FTH1 |JJJ1 |MON2 |MRPL22 |RCY1 |SDS24 |SLM6 |TLG2 |VMA2 |VPS53
Function/Process
Mutants/Phenotypes
Strains/Constructs
de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42
             |AAD4 |AIM22 |ALG12 |ALK2 |ARE2 |ARG2 |ARP5 |ASI2 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Tsukada M, et al. (1999) Structural and functional analysis of a novel coiled-coil protein involved in Ypt6 GTPase-regulated protein transport in yeast. Mol Biol Cell 10(1):63-75
       |IMH1 |KEX2 |USO1 |YPT6
Other Features
Fang H, et al. (1996) The homologue of mammalian SPC12 is important for efficient signal peptidase activity in Saccharomyces cerevisiae. J Biol Chem 271(28):16460-5
       |SEC11 |SPC1
DNA/RNA Sequence Features
Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Tsukada M and Gallwitz D (1996) Isolation and characterization of SYS genes from yeast, multicopy suppressors of the functional loss of the transport GTPase Ypt6p. J Cell Sci 109 ( Pt 10)():2471-81
       |IMH1 |KEX2 |SEC7 |SRO9 |YPT6

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.