---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

OST1/YJL002C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrX: 434644 to 433214 CDS: 434644 - 433214 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
OST1	YJL002C	NLT1	ORF, Verified	S000003539
Description
Alpha subunit of the oligosaccharyltransferase complex of the ER lumen, which catalyzes asparagine-linked glycosylation of newly synthesized proteins

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By dolichyl-diphosphooligosaccharide-protein glycotransferase activity Pathak R and Imperiali B (1997) A dual affinity tag on the 64-kDa Nlt1p subunit allows the rapid characterization of mutant yeast oligosaccharyl transferase complexes. Arch Biochem Biophys 338(1):1-6        IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007676 Assigned on 2007-05-23 UniProtKB GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.4.1.119 Assigned on 2007-05-23 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By cellular carbohydrate metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT glycoprotein metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT peptidyl-amino acid modification Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein amino acid N-linked glycosylation Pathak R and Imperiali B (1997) A dual affinity tag on the 64-kDa Nlt1p subunit allows the rapid characterization of mutant yeast oligosaccharyl transferase complexes. Arch Biochem Biophys 338(1):1-6        IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD protein amino acid N-linked glycosylation via asparagine Yan Q, et al. (1999) The Ost1p subunit of yeast oligosaccharyl transferase recognizes the peptide glycosylation site sequence, -Asn-X-Ser/Thr-. J Biol Chem 274(8):5021-5        IPI : Inferred from Physical Interaction Assigned on 2002-03-28 SGD protein amino acid glycosylation DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007676 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007676 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007676 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9905 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB oligosaccharyltransferase complex Karaoglu D, et al. (1997) The highly conserved Stt3 protein is a subunit of the yeast oligosaccharyltransferase and forms a subcomplex with Ost3p and Ost4p. J Biol Chem 272(51):32513-20        IPI : Inferred from Physical Interaction Assigned on 2005-05-04 SGD Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from Saccharomyces cerevisiae. Isolation of the OST6 gene, its synthetic interaction with OST3, and analysis of the native complex. J Biol Chem 274(24):17249-56        IPI : Inferred from Physical Interaction Assigned on 2002-03-28 SGD Schwarz M, et al. (2005) Yeast oligosaccharyltransferase consists of two functionally distinct sub-complexes, specified by either the Ost3p or Ost6p subunit. FEBS Lett 579(29):6564-8        IPI : Inferred from Physical Interaction Assigned on 2006-02-03 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for OST1/YJL002C for OST1 During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2). The oligosaccharyl transferase complex (OST complex) (EC 2.4.1.119) transfers 14-sugar branched oligosaccharides from dolichyl pyrophosphate to asparagine residues. The complex contains nine protein subunits: Ost1p, Ost2p, Ost3p, Ost4p, Ost5p, Ost6p, Stt3p, Swp1p, and Wbp1p, all of which are integral membrane proteins of the ER. The OST complex interacts with the Sec61p pore complex (3) involved in protein import into the ER. Ost1p is the alpha subunit of the OST complex, one of the original six subunits purified (4, 5). Also known as Nlt1p, for N-linked oligosaccharyl transferase (6), Ost1p was once thought to be responsible for recognition of the glycosylation target site in proteins (7), but this function is now assigned to Stt3p (8, 9, 10). Deletion of OST1 is lethal in haploid cells (4, 6), and temperature-sensitive (ts) mutants arrest within four generations (4). In addition to glycosylation defects, some ts mutants grow slowly and form clumps in liquid culture at the permissive temperature, possibly due to defective separation of mother and daughter cells (4). Ost1p is homologous to mammalian ribophorin I (OMIM) (4, 6), a component of the mammalian OST complex, along with ribophorin II (OMIM) and OST48 (OMIM). Last Updated: 2005-07-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forOST1/YJL002C for OST1 1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50        2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57      3) Chavan M, et al. (2005) Subunits of the translocon interact with components of the oligosaccharyl transferase complex. J Biol Chem 280(24):22917-24        4) Silberstein S, et al. (1995) The alpha subunit of the Saccharomyces cerevisiae oligosaccharyltransferase complex is essential for vegetative growth of yeast and is homologous to mammalian ribophorin I. J Cell Biol 128(4):525-36      5) Kelleher DJ and Gilmore R (1994) The Saccharomyces cerevisiae oligosaccharyltransferase is a protein complex composed of Wbp1p, Swp1p, and four additional polypeptides. J Biol Chem 269(17):12908-17      6) Pathak R, et al. (1995) The essential yeast NLT1 gene encodes the 64 kDa glycoprotein subunit of the oligosaccharyl transferase. FEBS Lett 362(2):229-34        7) Yan Q, et al. (1999) The Ost1p subunit of yeast oligosaccharyl transferase recognizes the peptide glycosylation site sequence, -Asn-X-Ser/Thr-. J Biol Chem 274(8):5021-5        8) Yan Q and Lennarz WJ (2002) Studies on the function of oligosaccharyl transferase subunits. Stt3p is directly involved in the glycosylation process. J Biol Chem 277(49):47692-700        9) Yan Q and Lennarz WJ (2002) Studies on the function of oligosaccharyl transferase subunits: a glycosylatable photoprobe binds to the luminal domain of Ost1p. Proc Natl Acad Sci U S A 99(25):15994-9          10) Nilsson I, et al. (2003) Photocross-linking of nascent chains to the STT3 subunit of the oligosaccharyltransferase complex. J Cell Biol 161(4):715-25        11) Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from yeast. Biochim Biophys Acta 1426(2):259-73

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for OST1/YJL002C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for OST1/YJL002C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MRQVWFS C-term LNMNVTN Length(aa) 476 MW(Da) 54,071 pI 4.88 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.122   Codon Adaptation Index 0.165   Frequency of Optimal Codons 0.487   Hydropathicity of Protein -0.159   Aromaticity Score 0.143

10 20 30 40 50 | | | | | MRQVWFSWIVGLFLCFFNVSSAAQYEPPATWENVDYKRTIDVSNAYISET IEITIKNIASEPATEYFTAFESGIFSKVSFFSAYFTNEATFLNSQLLANS TTAPGDDGESEIRYGIIQFPNAISPQEEVSLVIKSFYNTVGIPYPEHVGM SEEQHLLWETNRLPLSAYDTKKASFTLIGSSSFEEYHPPNDESLLGKANG NSFEFGPWEDIPRFSSNETLAIVYSHNAPLNQVVNLRRDIWLSHWASTIQ FEEYYELTNKAAKLSKGFSRLELMKQIQTQNMRQTHFVTVLDMLLPEGAT DHYFTDLVGLVSTSHAERDHFFIRPRFPIFGGWNYNFTVGWTNKLSDFLH VSSGSDEKFVASIPILNGPPDTVYDNVELSVFLPEGAEIFDIDSPVPFTN VSIETQKSYFDLNKGHVKLTFSYRNLISQVANGQVLIKYDYPKSSFFKKP LSIACYIFTALMGVFVLKTLNMNVTN*

Protein Structures from PDB: proteins of known structure with sequence similarity to OST1/YJL002C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
OST1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YJL002C	SGD Systematic Sequence
853455	NCBI: Gene ID
NP_012532.1	NCBI: RefSeq protein version ID
NP_012532.1	NCBI: RefSeq protein version ID
6322458	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
49 curated references; 0 references not yet curated
Protein Physical Properties Protein-protein Interactions Techniques and Reagents	Harada Y, et al. (2009) Oligosaccharyltransferase directly binds to ribosome at a location near the translocon-binding site. Proc Natl Acad Sci U S A 106(17):6945-9	|NIP7 |NMD3 |OST2 |OST3 |OST4 |OST5 |OST6 |RDN25-1 |RDN25-2 |RDN5-1 |RDN5-2 |RDN5-3 |RDN5-4 |RDN5-5 |MORE
Cross-species Expression Mutants/Phenotypes Strains/Constructs	Hese K, et al. (2009) The yeast oligosaccharyltransferase complex can be replaced by STT3 from Leishmania major. Glycobiology 19(2):160-171	|OST2 |STT3 |SWP1 |WBP1
Computational analysis Large-scale protein interaction	Wu M, et al. (2009) A core-attachment based method to detect protein complexes in PPI networks. BMC Bioinformatics 10:169	|DAD1 |DAM1 |GPI2 |HAP2 |HAP3 |HAP5 |MTH1 |OST2 |OST3 |OST4 |OST5 |OST6 |PEP3 |PEP5 |MORE
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Fungal Related Genes/Proteins	Deshpande N, et al. (2008) Protein glycosylation pathways in filamentous fungi. Glycobiology 18(8):626-37	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |MORE
Reviews	Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |MORE
Protein/Nucleic Acid Structure Strains/Constructs Techniques and Reagents	Li H, et al. (2008) Structure of the oligosaccharyl transferase complex at 12 a resolution. Structure 16(3):432-40	|STT3 |SWP1 |WBP1
Cross-species Expression Mutants/Phenotypes Strains/Constructs	Nasab FP, et al. (2008) All in One: Leishmania major STT3 Proteins Substitute for the Whole Oligosaccharyltransferase Complex in Saccharomyces cerevisiae. Mol Biol Cell 19(9):3758-3768	|OST2 |STT3 |SWP1 |WBP1
Genetic Interactions Large-scale genetic interaction	Qi Y, et al. (2008) Finding friends and enemies in an enemies-only network: A graph diffusion kernel for predicting novel genetic interactions and co-complex membership from yeast genetic interactions. Genome Res 18(12):1991-2004	|AAH1 |ADA2 |AGE1 |AGE2 |AIM29 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |ANP1 |ARL3 |ARP3 |ARP4 |MORE
Function/Process Non-Fungal Related Genes/Proteins Protein Physical Properties Substrates/Ligands/Cofactors	Kelleher DJ, et al. (2007) Dolichol-linked oligosaccharide selection by the oligosaccharyltransferase in protist and fungal organisms. J Cell Biol 177(1):29-37	|OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Protein Physical Properties Substrates/Ligands/Cofactors Techniques and Reagents	Kohda D, et al. (2007) New oligosaccharyltransferase assay method. Glycobiology 17(11):1175-82	|OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Reviews	Lennarz WJ (2007) Studies on oligosaccharyl transferase in yeast. Acta Biochim Pol 54(4):673-7	|OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Cellular Location Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure Techniques and Reagents	Chavan M, et al. (2006) Dimeric organization of the yeast oligosaccharyl transferase complex. Proc Natl Acad Sci U S A 103(24):8947-52	|OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Reviews	Kelleher DJ and Gilmore R (2006) An evolving view of the eukaryotic oligosaccharyltransferase. Glycobiology 16(4):47R-62R	|OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Reviews	Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |MORE
RNA Levels and Processing Regulation of	Tanaka F, et al. (2006) Functional genomic analysis of commercial baker's yeast during initial stages of model dough-fermentation. Food Microbiol 23(8):717-28	|ACE2 |ACO1 |ACS1 |ACS2 |ACT1 |ADH1 |ADH2 |ADH5 |ADK1 |AIM38 |ALD2 |ALG8 |ARG1 |ARG3 |MORE
Cellular Location Strains/Constructs	Voeltz GK, et al. (2006) A class of membrane proteins shaping the tubular endoplasmic reticulum. Cell 124(3):573-86	|ERG3 |ERP2 |RTN1 |RTN2 |SEC63 |SUR2 |WBP1 |YOP1
Reviews	Weerapana E and Imperiali B (2006) Asparagine-linked protein glycosylation: from eukaryotic to prokaryotic systems. Glycobiology 16(6):91R-101R	|ALG1 |ALG11 |ALG13 |ALG14 |ALG2 |ALG7 |ALG9 |OST2 |OST3 |OST4 |OST5 |OST6 |RFT1 |SEC11 |MORE
Function/Process Protein-protein Interactions Strains/Constructs Techniques and Reagents	Chavan M, et al. (2005) Subunits of the translocon interact with components of the oligosaccharyl transferase complex. J Biol Chem 280(24):22917-24	|OST2 |OST3 |OST4 |OST5 |OST6 |SBH1 |SEC61 |SSS1 |STT3 |SWP1 |WBP1
Reviews	Jones J, et al. (2005) Controlling N-linked glycan site occupancy. Biochim Biophys Acta 1726(2):121-37	|MNL1 |OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Strains/Constructs	Li G, et al. (2005) Studies on the N-glycosylation of the subunits of oligosaccharyl transferase in Saccharomyces cerevisiae. J Biol Chem 280(3):1864-71	|STT3 |WBP1
Function/Process Genetic Interactions	Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19	|ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Cellular Location Function/Process Protein-protein Interactions	Schwarz M, et al. (2005) Yeast oligosaccharyltransferase consists of two functionally distinct sub-complexes, specified by either the Ost3p or Ost6p subunit. FEBS Lett 579(29):6564-8	|OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Function/Process Protein-protein Interactions	Spirig U, et al. (2005) The 3.4-kDa Ost4 protein is required for the assembly of two distinct oligosaccharyltransferase complexes in yeast. Glycobiology 15(12):1396-406	|OST3 |OST4 |OST6 |STT3 |SWP1 |WBP1
Protein-protein Interactions Strains/Constructs	Yan A and Lennarz WJ (2005) Two oligosaccharyl transferase complexes exist in yeast and associate with two different translocons. Glycobiology 15(12):1407-15	|ALG1 |OST2 |OST3 |OST4 |OST5 |OST6 |SBH1 |SBH2 |SWP1 |WBP1
Reviews	Yan A and Lennarz WJ (2005) Unraveling the mechanism of protein N-glycosylation. J Biol Chem 280(5):3121-4	|OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Protein Sequence Features Strains/Constructs Techniques and Reagents	Dempski RE Jr and Imperiali B (2004) Heterologous expression and biophysical characterization of soluble oligosaccharyl transferase subunits. Arch Biochem Biophys 431(1):63-70	|SWP1 |WBP1
Cellular Location Function/Process Protein-protein Interactions Strains/Constructs	Yan A, et al. (2003) New findings on interactions among the yeast oligosaccharyl transferase subunits using a chemical cross-linker. J Biol Chem 278(35):33078-87	|OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Cellular Location Function/Process Substrates/Ligands/Cofactors	Yan Q and Lennarz WJ (2002) Studies on the function of oligosaccharyl transferase subunits. Stt3p is directly involved in the glycosylation process. J Biol Chem 277(49):47692-700	|OST3 |STT3
Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Yan Q and Lennarz WJ (2002) Studies on the function of oligosaccharyl transferase subunits: a glycosylatable photoprobe binds to the luminal domain of Ost1p. Proc Natl Acad Sci U S A 99(25):15994-9	|STT3
Protein-protein Interactions	Massaad MJ and Herscovics A (2001) Interaction of the endoplasmic reticulum alpha 1,2-mannosidase Mns1p with Rer1p using the split-ubiquitin system. J Cell Sci 114(Pt 24):4629-35	|ALG5 |MNS1 |RER1 |SEC12
Protein-protein Interactions	Park H and Lennarz WJ (2000) Evidence for interaction of yeast protein kinase C with several subunits of oligosaccharyl transferase. Glycobiology 10(7):737-44	|OST3 |PKC1 |STT3 |SWP1 |WBP1
Cellular Location Function/Process Protein-protein Interactions Techniques and Reagents	Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from Saccharomyces cerevisiae. Isolation of the OST6 gene, its synthetic interaction with OST3, and analysis of the native complex. J Biol Chem 274(24):17249-56	|OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Reviews	Knauer R and Lehle L (1999) The oligosaccharyltransferase complex from yeast. Biochim Biophys Acta 1426(2):259-73	|OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1
Function/Process Substrates/Ligands/Cofactors Techniques and Reagents	Yan Q, et al. (1999) The Ost1p subunit of yeast oligosaccharyl transferase recognizes the peptide glycosylation site sequence, -Asn-X-Ser/Thr-. J Biol Chem 274(8):5021-5
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Silberstein S, et al. (1998) A role for the DnaJ homologue Scj1p in protein folding in the yeast endoplasmic reticulum. J Cell Biol 143(4):921-33	|JEM1 |KAR2 |OST3 |SCJ1 |SEC63
Cellular Location Function/Process Protein-protein Interactions Techniques and Reagents	Stagljar I, et al. (1998) A genetic system based on split-ubiquitin for the analysis of interactions between membrane proteins in vivo. Proc Natl Acad Sci U S A 95(9):5187-92	|ALG5 |WBP1
Cellular Location Function/Process Protein-protein Interactions Techniques and Reagents	Karaoglu D, et al. (1997) The highly conserved Stt3 protein is a subunit of the yeast oligosaccharyltransferase and forms a subcomplex with Ost3p and Ost4p. J Biol Chem 272(51):32513-20	|OST2 |OST3 |OST4 |OST5 |STT3 |SWP1 |WBP1
Protein Physical Properties Protein-protein Interactions Techniques and Reagents	Pathak R and Imperiali B (1997) A dual affinity tag on the 64-kDa Nlt1p subunit allows the rapid characterization of mutant yeast oligosaccharyl transferase complexes. Arch Biochem Biophys 338(1):1-6
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Reiss G, et al. (1997) A specific screen for oligosaccharyltransferase mutations identifies the 9 kDa OST5 protein required for optimal activity in vivo and in vitro. EMBO J 16(6):1164-72	|OST2 |OST3 |OST5 |STT3 |SWP1 |WBP1
Cellular Location Function/Process Protein-protein Interactions Techniques and Reagents	Spirig U, et al. (1997) The STT3 protein is a component of the yeast oligosaccharyltransferase complex. Mol Gen Genet 256(6):628-37	|OST3 |OST4 |STT3 |SWP1 |WBP1
Reviews	Silberstein S and Gilmore R (1996) Biochemistry, molecular biology, and genetics of the oligosaccharyltransferase. FASEB J 10(8):849-58	|OST2 |OST3 |OST4 |OST5 |STT3 |SWP1 |WBP1
Cellular Location Function/Process Mutants/Phenotypes Protein Physical Properties Strains/Constructs	Karaoglu D, et al. (1995) Functional characterization of Ost3p. Loss of the 34-kD subunit of the Saccharomyces cerevisiae oligosaccharyltransferase results in biased underglycosylation of acceptor substrates. J Cell Biol 130(3):567-77	|ALG5 |OST3 |SWP1 |WBP1
Alias Cellular Location Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Physical Properties Protein Processing/Modification/Regulation Protein Sequence Features Strains/Constructs	Pathak R, et al. (1995) The essential yeast NLT1 gene encodes the 64 kDa glycoprotein subunit of the oligosaccharyl transferase. FEBS Lett 362(2):229-34
Cellular Location Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Silberstein S, et al. (1995) The alpha subunit of the Saccharomyces cerevisiae oligosaccharyltransferase complex is essential for vegetative growth of yeast and is homologous to mammalian ribophorin I. J Cell Biol 128(4):525-36	|KAR2 |SWP1 |WBP1
Cellular Location Function/Process	Silberstein S, et al. (1995) The essential OST2 gene encodes the 16-kD subunit of the yeast oligosaccharyltransferase, a highly conserved protein expressed in diverse eukaryotic organisms. J Cell Biol 131(2):371-83	|OST2 |OST3 |SWP1 |WBP1
Cellular Location Protein Physical Properties Protein Processing/Modification/Regulation Techniques and Reagents	Kelleher DJ and Gilmore R (1994) The Saccharomyces cerevisiae oligosaccharyltransferase is a protein complex composed of Wbp1p, Swp1p, and four additional polypeptides. J Biol Chem 269(17):12908-17	|OST2 |OST3 |OST5 |SWP1 |WBP1
Cellular Location Non-Fungal Related Genes/Proteins Protein Physical Properties Protein-protein Interactions Techniques and Reagents	Knauer R and Lehle L (1994) The N-oligosaccharyltransferase complex from yeast. FEBS Lett 344(1):83-6	|SWP1 |WBP1
Alias Substrates/Ligands/Cofactors	Trimble RB, et al. (1980) Effect of glucosylation of lipid intermediates on oligosaccharide transfer in solubilized microsomes from Saccharomyces cerevisiae. J Biol Chem 255(24):11892-5	|OST2 |OST3 |OST4 |OST5 |OST6 |STT3 |SWP1 |WBP1

Return to SGD

Send a Message to the SGD Curators