PMT6/YGR199W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrVII: 897507 to 899786
CDS: 897507 - 899786

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

PMT6 YGR199W ORF, Verified S000003431

Description
Protein O-mannosyltransferase, transfers mannose from dolichyl phosphate-D-mannose to protein serine/threonine residues of secretory proteins; reaction is essential for cell wall rigidity; member of a family of mannosyltransferases

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
dolichyl-phosphate-mannose-protein mannosyltransferase activity Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9
     TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
     IEA : Inferred from Electronic Annotation with IUBMB:2.4.1.109
Assigned on 2007-05-23 UniProtKB
mannosyltransferase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003342
Assigned on 2007-05-23 UniProtKB
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0328
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
protein amino acid O-linked glycosylation Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9
     TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003342
Assigned on 2007-05-23 UniProtKB
regulation of transport Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9
     TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR003342 , EBI:IPR003608 , EBI:IPR016093
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
protein modifications

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forPMT6/YGR199W for PMT6
1) Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PMT6/YGR199W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PMT6/YGR199W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSKAKGT

C-term STWDIAP

Length(aa) 759

MW(Da) 88,025

pI 6.83

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.010

Codon Adaptation Index 0.126

Frequency of Optimal Codons 0.407

Hydropathicity of Protein -0.053

Aromaticity Score 0.154

10 20 30 40 50 | | | | | MSKAKGTGFSSIDTEDENLRERYVNQPKANASDIQDEQLDCFEQLEEKHR TKKNEEYTALKILRDVIGPLLLTITSFYLRFQHIDQNNYVVWDEAHFGKF GSYYIKHEYYHDVHPPLGKMLIALSEWMAGFDGQFDFSSNNAYPENVNFK LMRQFNATFGALCTPVAFFTAKWMGFNYFTVYLIATMVTLEHSYIVLSKF ILLDSMLLFFSMTTFACMIKLYTLRKQQMTKKWSLWMLLTGLSIGCVCSV KWVGLFITVVVGLYTCIELFLLYCDKELPRIKYYKHWLIRIINLIVIPFL IYLYCFKIHFVLLYKSGTGDSTTNTLFQINLEGTQIEAGPRDVAFGSELT IRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLE LDQNGTLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGY GSQSVGDEKDDWIVEIVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLG CYLASTGLTYPAWGFKQAEIVCKDSWSRRDKSTWWNVEDHWNHNLETAED YVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDSLSSDAWEWPTLHKGL RMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQTLYLS DDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGF VLDFTLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQ WLSTWDIAP*

Protein Structures from PDB: proteins of known structure with sequence similarity to PMT6/YGR199W, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to PMT6 Homolog Source (per PDB) Protein Alignment: PMT6 vs. Homolog External Links
P-Value %Identical %Similar Alignment
1t9f ( Chain: A)
Structural genomics of caenorhabditis elegans: structure of a protein with unknown function
PDB_Info
PDB_Structure
Caenorhabditis elegans 9.9e-08 33 21 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
PMT6 SGD (2007) Information without a citation in SGD

Standard Name	Reference
PMT6	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YGR199W SGD Systematic Sequence

853113 NCBI: Gene ID

NP_011715.1 NCBI: RefSeq protein version ID

NP_011715.1 NCBI: RefSeq protein version ID

6321638 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YGR199W	SGD Systematic Sequence
853113	NCBI: Gene ID
NP_011715.1	NCBI: RefSeq protein version ID
NP_011715.1	NCBI: RefSeq protein version ID
6321638	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
17 curated references; 0 references not yet curated
Reviews
Chiba Y and Akeboshi H (2009) Glycan engineering and production of 'humanized' glycoprotein in yeast cells. Biol Pharm Bull 32(5):786-95
       |KTR6 |MNN1 |MNN4 |OCH1 |PMT1 |PMT2 |PMT3 |PMT4 |PMT5
Genomic expression study
RNA Levels and Processing
Del Vescovo V, et al. (2008) Role of Hog1 and Yaf9 in the transcriptional response of Saccharomyces cerevisiae to cesium chloride. Physiol Genomics 33(1):110-20
       |AGA1 |ALD3 |ARO10 |ATG1 |BRL1 |CAR2 |CMK2 |COX5B |CPR1 |CPR7 |CWP1 |CYC7 |DAN4 |DDR48 |MORE
Mutants/Phenotypes
Strains/Constructs
Hirayama H, et al. (2008) O-Mannosylation is Required for Degradation of the Endoplasmic Reticulum-associated Degradation Substrate Gas1*p via the Ubiquitin/Proteasome Pathway in Saccharomyces cerevisiae. J Biochem 143(4):555-67
     |GAS1 |KRE2 |KTR1 |KTR3 |PEP4 |PMT1 |PMT2 |PMT4 |VPS30 |VPS38
Reviews
Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |MORE
Reviews
Lengeler KB, et al. (2008) Protein-O-mannosyltransferases in virulence and development. Cell Mol Life Sci 65(4):528-44
       |AGA1 |AGA2 |AXL2 |BAR1 |CIS3 |CTS1 |FUS1 |GAS1 |HSP150 |KEX2 |KRE9 |MID2 |PIR1 |PIR3 |MORE
Reviews
Goto M (2007) Protein o-glycosylation in fungi: diverse structures and multiple functions. Biosci Biotechnol Biochem 71(6):1415-27
       |BAR1 |CTS1 |GAS1 |HSP150 |KEX2 |KRE2 |KRE9 |KTR1 |KTR3 |PMT1 |PMT2 |PMT3 |PMT4 |PMT5 |MORE
Reviews
Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Frieman MB and Cormack BP (2004) Multiple sequence signals determine the distribution of glycosylphosphatidylinositol proteins between the plasma membrane and cell wall in Saccharomyces cerevisiae. Microbiology 150(Pt 10):3105-14
       |FLO1 |FLO9 |KRE2 |KTR1 |KTR3 |MNN1 |MNN9 |PMT1 |PMT2 |PMT3 |PMT4 |PMT5
Fungal Related Genes/Proteins
Shaw BD and Momany M (2002) Aspergillus nidulans polarity mutant swoA is complemented by protein O-mannosyltransferase pmtA. Fungal Genet Biol 37(3):263-70
           |PMT2 |PMT3
Function/Process
Fungal Related Genes/Proteins
Reviews
Ernst JF and Prill SK (2001) O-glycosylation. Med Mycol 39 Suppl 1:67-74
       |PMT1
Fungal Related Genes/Proteins
Protein Sequence Features
Girrbach V, et al. (2000) Structure-function analysis of the dolichyl phosphate-mannose: protein O-mannosyltransferase ScPmt1p. J Biol Chem 275(25):19288-96
       |PMT1 |PMT2 |PMT3 |PMT4 |PMT5
Fungal Related Genes/Proteins
Timpel C, et al. (2000) Morphogenesis, adhesive properties, and antifungal resistance depend on the Pmt6 protein mannosyltransferase in the fungal pathogen candida albicans. J Bacteriol 182(11):3063-71

Function/Process
Fungal Related Genes/Proteins
Romero PA, et al. (1999) Mnt2p and Mnt3p of Saccharomyces cerevisiae are members of the Mnn1p family of alpha-1,3-mannosyltransferases responsible for adding the terminal mannose residues of O-linked oligosaccharides. Glycobiology 9(10):1045-51
       |MNN1 |MNT2 |MNT3 |MNT4 |PMT1 |PMT2 |PMT3 |PMT4 |PMT5
Strains/Constructs
Timpel C, et al. (1998) Multiple functions of Pmt1p-mediated protein O-mannosylation in the fungal pathogen Candida albicans. J Biol Chem 273(33):20837-46
       |PMT1 |PMT2 |PMT3 |PMT4 |PMT5
Function/Process
Fungal Related Genes/Proteins
Gentzsch M and Tanner W (1997) Protein-O-glycosylation in yeast: protein-specific mannosyltransferases. Glycobiology 7(4):481-6
     |AGA2 |BAR1 |CTS1 |GAS1 |HSP150 |KEX2 |KRE9 |PMT1 |PMT2 |PMT3 |PMT4 |PMT5
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Substrates/Ligands/Cofactors
Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9
     |GAS1 |PMT1 |PMT2 |PMT3 |PMT4 |PMT5 |PMT7
Alias
DNA/RNA Sequence Features
Fungal Related Genes/Proteins
Mapping
Protein Sequence Features
Guerreiro P, et al. (1996) Sequencing of a 17.6 kb segment on the right arm of yeast chromosome VII reveals 12 ORFs, including CCT, ADE3 and TR-I genes, homologues of the yeast PMT and EF1G genes, of the human and bacterial electron-transferring flavoproteins (beta-chain) and of the Escherichia coli phosphoserine phosphohydrolase, and five new ORFs. Yeast 12(3):273-80
     |ADE3 |CAM1 |CIR1 |ELP2 |MVB12 |PCT1 |PMT1 |PMT2 |SER2 |TDA10 |TEF4 |TRX2 |YCH1 |YGR201C |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.