---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ERG1/YGR175C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVII: 848428 to 846938 CDS: 848428 - 846938 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ERG1	YGR175C		ORF, Verified	S000003407
Description
Squalene epoxidase, catalyzes the epoxidation of squalene to 2,3-oxidosqualene; plays an essential role in the ergosterol-biosynthesis pathway and is the specific target of the antifungal drug terbinafine

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By FAD binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR013698 Assigned on 2008-10-13 UniProtKB drug binding Leber R, et al. (2003) Molecular mechanism of terbinafine resistance in Saccharomyces cerevisiae. Antimicrob Agents Chemother 47(12):3890-900        IMP : Inferred from Mutant Phenotype Assigned on 2004-08-13 SGD oxidoreductase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003042 Assigned on 2009-11-20 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2009-11-20 UniProtKB squalene monooxygenase activity Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR013698 Assigned on 2008-10-13 UniProtKB GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:1.14.99.7 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By ergosterol biosynthetic process Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD metabolic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003042 Assigned on 2007-05-23 UniProtKB oxidation reduction DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR013698 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2008-05-21 UniProtKB secondary metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    TAS : Traceable Author Statement Assigned on 2001-01-19 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2008-02-14 UniProtKB integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR013698 Assigned on 2009-01-12 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB lipid particle Leber R, et al. (1998) Dual localization of squalene epoxidase, Erg1p, in yeast reflects a relationship between the endoplasmic reticulum and lipid particles. Mol Biol Cell 9(2):375-86        IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-01-12 UniProtKB microsome GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0492 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
ergosterol biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ERG1/YGR175C for ERG1 ERG1 encodes squalene monooxygenase (also called squalene epoxidase), an enzyme that oxidizes squalene to form squalene 2,3-epoxide, an intermediate in ergosterol biosynthesis (1, 2, 3, 4). ERG1 is essential under aerobic growth conditions, but erg1 null mutants are viable when grown under anaerobic conditions in the presence of ergosterol (5). Mutations in erg1 also cause resistance to allylamine (1). The activity of Erg1p varies depending on that availability of oxygen and ergosterol, suggesting that squalene monooxygenase may be involved in regulating sterol biosynthesis (6). Erg1p is found in the endoplasmic reticulum (ER) and in lipid particles, but only the ER pool has enzymatic activity (7). Last Updated: 2000-08-29

Basic References [TOP]

BASIC INFORMATION REFERENCES forERG1/YGR175C for ERG1 1) Jandrositz A, et al. (1991) The gene encoding squalene epoxidase from Saccharomyces cerevisiae: cloning and characterization. Gene 107(1):155-60      2) Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    3) Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6      4) Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30      5) Landl KM, et al. (1996) ERG1, encoding squalene epoxidase, is located on the right arm of chromosome VII of Saccharomyces cerevisiae. Yeast 12(6):609-13      6) M'Baya B, et al. (1989) Regulation of squalene synthetase and squalene epoxidase activities in Saccharomyces cerevisiae. Lipids 24(12):1020-3      7) Leber R, et al. (1998) Dual localization of squalene epoxidase, Erg1p, in yeast reflects a relationship between the endoplasmic reticulum and lipid particles. Mol Biol Cell 9(2):375-86        8) Satoh T, et al. (1993) Enzymatic properties of squalene epoxidase from Saccharomyces cerevisiae. Biol Pharm Bull 16(4):349-52

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERG1/YGR175C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERG1/YGR175C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSAVNVA C-term LFGELIG Length(aa) 496 MW(Da) 55,125 pI 6.45 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.527   Codon Adaptation Index 0.441   Frequency of Optimal Codons 0.718   Hydropathicity of Protein -0.008   Aromaticity Score 0.087

10 20 30 40 50 | | | | | MSAVNVAPELINADNTITYDAIVIGAGVIGPCVATGLARKGKKVLIVERD WAMPDRIVGELMQPGGVRALRSLGMIQSINNIEAYPVTGYTVFFNGEQVD IPYPYKADIPKVEKLKDLVKDGNDKVLEDSTIHIKDYEDDERERGVAFVH GRFLNNLRNITAQEPNVTRVQGNCIEILKDEKNEVVGAKVDIDGRGKVEF KAHLTFICDGIFSRFRKELHPDHVPTVGSSFVGMSLFNAKNPAPMHGHVI LGSDHMPILVYQISPEETRILCAYNSPKVPADIKSWMIKDVQPFIPKSLR PSFDEAVSQGKFRAMPNSYLPARQNDVTGMCVIGDALNMRHPLTGGGMTV GLHDVVLLIKKIGDLDFSDREKVLDELLDYHFERKSYDSVINVLSVALYS LFAADSDNLKALQKGCFKYFQRGGDCVNKPVEFLSGVLPKPLQLTRVFFA VAFYTIYLNMEERGFLGLPMALLEGIMILITAIRVFTPFLFGELIG*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERG1/YGR175C, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to ERG1 Homolog Source (per PDB) Protein Alignment: ERG1 vs. Homolog External Links P-Value %Identical %Similar Alignment 3e1t ( Chain: A) Structure and action of the myxobacterial chondrochloren halogenase cndh, a new variant of fad-dependent halogenases PDB_Info PDB_Structure Chondromyces crocatus 0.004897 22 31 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ERG1	SGD (2007) Information without a citation in SGD

Mapping Notes

Date	Note
1997-10-20	Edition 14: ERG1 encodes squalene epoxidase, an FAD-containing mixed-function oxygenase (monooxygenase) which introduces molecular oxygen into the 2,3-position of squalene Cherry JM, et al. (1997) Genetic and physical maps of Saccharomyces cerevisiae. Nature 387(6632 Suppl):67-73

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YGR175C	SGD Systematic Sequence
853086	NCBI: Gene ID
NP_011691.1	NCBI: RefSeq protein version ID
NP_011691.1	NCBI: RefSeq protein version ID
6321614	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
68 curated references; 0 references not yet curated
Other Features	Connerth M, et al. (2009) Analysis of lipid particles from yeast. Methods Mol Biol 579:359-74	|AYR1 |ERG6 |ERG7 |POR1 |PRC1 |SEC61 |WBP1
Reviews	Goodman JM (2009) Demonstrated and inferred metabolism associated with cytosolic lipid droplets. J Lipid Res 50(11):2148-56	|AYR1 |DGA1 |EHT1 |ERG26 |ERG27 |ERG6 |ERG7 |FAA1 |FAA4 |FAT1 |SLC1 |TGL1 |TGL3 |TGL4 |MORE
RNA Levels and Processing	Pedroso N, et al. (2009) Modulation of plasma membrane lipid profile and microdomains by H(2)O(2) in Saccharomyces cerevisiae. Free Radic Biol Med 46(2):289-98	|ACC1 |ELO1 |ERG25 |ERG3 |ERG6 |ERG7 |FAS1 |FEN1 |GPT2 |LAC1 |LIP1 |OLE1 |RAD27 |SUR4
Regulation of Transcription	Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461	|AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
RNA Levels and Processing	Verbelen PJ, et al. (2009) The influence of yeast oxygenation prior to brewery fermentation on yeast metabolism and the oxidative stress response. FEMS Yeast Res 9(2):226-39	|ACT1 |ARE2 |COX15 |CTA1 |CTT1 |CYC1 |CYC7 |ERG11 |HAP1 |HSP12 |OLE1 |PAU5 |QCR9 |ROX1 |MORE
Regulation of Transcription	Verbelen PJ, et al. (2009) The role of oxygen in yeast metabolism during high cell density brewery fermentations. Appl Microbiol Biotechnol 82(6):1143-56	|ATF1 |BAP2 |CTT1 |HSP12 |ILV2 |ILV5 |OLE1 |SOD1
Transcription	Zara G, et al. (2009) Oxygen is required to restore flor strain viability and lipid biosynthesis under fermentative conditions. FEMS Yeast Res 9(2):217-25	|ACC1 |ACS1 |ACS2 |ARE1 |ARE2 |ERG11 |OLE1
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Techniques and Reagents	Czabany T, et al. (2008) Structural and Biochemical Properties of Lipid Particles from the Yeast Saccharomyces cerevisiae. J Biol Chem 283(25):17065-17074	|ARE1 |ARE2 |DGA1 |LRO1 |POR1 |PRC1 |WBP1
Mutants/Phenotypes	Gresham D, et al. (2008) The repertoire and dynamics of evolutionary adaptations to controlled nutrient-limited environments in yeast. PLoS Genet 4(12):e1000303	|ADH2 |BNI5 |BRR2 |CCR4 |CIT2 |CIT3 |CKA2 |CST9 |DCI1 |GIN4 |GSH1 |HXT1 |HXT2 |HXT3 |MORE
Function/Process	Han S and Kim D (2008) Inference of protein complex activities from chemical-genetic profile and its applications: predicting drug-target pathways. PLoS Comput Biol 4(8):e1000162	|CUL3 |ELP3 |MEC1 |RUB1 |SEC2 |TAT1 |TEF4 |TEL1 |TOP1 |TOR1 |TOR2 |UBA3 |ULA1
Mutants/Phenotypes Protein Physical Properties Protein Processing/Modification/Regulation Protein Sequence Features Strains/Constructs	Ruckenstuhl C, et al. (2008) Structure-Function Correlations of Two Highly Conserved Motifs in Saccharomyces cerevisiae Squalene Epoxidase. Antimicrob Agents Chemother 52(4):1496-9
Genomic expression study Large-scale protein detection	Castrillo JI, et al. (2007) Growth control of the eukaryote cell: a systems biology study in yeast. J Biol 6(2):4	|ACO1 |ACO2 |ADH4 |ADO1 |ALD5 |ARG8 |CDC33 |CPA1 |CPA2 |DDI1 |DPP1 |ENO1 |ERG27 |ERO1 |MORE
Substrates/Ligands/Cofactors	Daicho K, et al. (2007) The ergosterol biosynthesis inhibitor zaragozic acid promotes vacuolar degradation of the tryptophan permease Tat2p in yeast. Biochim Biophys Acta 1768(7):1681-1690	|ERG11 |ERG6 |ERG9 |PEP12 |PEP4 |RSP5 |TAT2 |VPS1 |VPS27 |VPS45
Cell Growth and Metabolism Reviews	Daum G, et al. (2007) Lipid storage and mobilization pathways in yeast. Novartis Found Symp 286:142-51; discussion 151-4, 162-3, 196-203	|ARE1 |ARE2 |DGA1 |LRO1 |TGL1 |TGL3 |TGL4 |TGL5 |YEH1 |YEH2
Infection and Antifungals Mutants/Phenotypes Protein/Nucleic Acid Structure Regulation of Strains/Constructs Transcription	Ruckenstuhl C, et al. (2007) Characterization of Squalene Epoxidase of Saccharomyces cerevisiae by Applying Terbinafine-Sensitive Variants. Antimicrob Agents Chemother 51(1):275-84
Reviews	Schulz TA and Prinz WA (2007) Sterol transport in yeast and the oxysterol binding protein homologue (OSH) family. Biochim Biophys Acta 1771(6):769-80	|AUS1 |CAT5 |DAN1 |ERG11 |ERG27 |ERG3 |ERG5 |ERG6 |ERG7 |HES1 |KES1 |MGM101 |NCR1 |NPC2 |MORE
Regulation of	de Groot MJ, et al. (2007) Quantitative proteomics and transcriptomics of anaerobic and aerobic yeast cultures reveals post-transcriptional regulation of key cellular processes. Microbiology 153(Pt 11):3864-3878	|ACO1 |ACO2 |ACS1 |ACS2 |ADE13 |ADE17 |ADE2 |ADE3 |ADE4 |ADE5,7 |ADE6 |ADH1 |ADH2 |ADH5 |MORE
Fungal Related Genes/Proteins Mutants/Phenotypes	Snoek IS and Steensma HY (2006) Why does Kluyveromyces lactis not grow under anaerobic conditions? Comparison of essential anaerobic genes of Saccharomyces cerevisiae with the Kluyveromyces lactis genome. FEMS Yeast Res 6(3):393-403	|ACP1 |ARB1 |ARG82 |ARH1 |ARV1 |ATM1 |BTS1 |BUR6 |CAB2 |CAX4 |CDC40 |CNM67 |CTF4 |DBP7 |MORE
Protein Processing/Modification/Regulation Techniques and Reagents	Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48	|AAC1 |AAC3 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Altmann K and Westermann B (2005) Role of essential genes in mitochondrial morphogenesis in Saccharomyces cerevisiae. Mol Biol Cell 16(11):5410-7	|ARC35 |ARC40 |ARP2 |BFR2 |CCT4 |CCT6 |CDC34 |CDC53 |COF1 |DSL1 |ERG10 |ERG12 |ERG13 |ERG25 |MORE
Mutants/Phenotypes RNA Levels and Processing Techniques and Reagents	Buurman ET, et al. (2005) Utilization of target-specific, hypersensitive strains of Saccharomyces cerevisiae to determine the mode of action of antifungal compounds. Antimicrob Agents Chemother 49(6):2558-60	|AUR1 |ERG11 |ERG7 |ERG8 |ERG9 |LCB1 |PKC1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52	|ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
RNA Levels and Processing Regulation of	Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91	|AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE
Protein-protein Interactions Techniques and Reagents	Mo C and Bard M (2005) A systematic study of yeast sterol biosynthetic protein-protein interactions using the split-ubiquitin system. Biochim Biophys Acta 1737(2-3):152-60	|ERG11 |ERG2 |ERG24 |ERG25 |ERG26 |ERG27 |ERG28 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG9
Protein-protein Interactions	Mo C and Bard M (2005) Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex. J Lipid Res 46(9):1991-8	|ERG11 |ERG25 |ERG26 |ERG27 |ERG28 |ERG6
Non-Fungal Related Genes/Proteins Protein Sequence Features Reviews	Ruckenstuhl C, et al. (2005) Single amino acid exchanges in FAD-binding domains of squalene epoxidase of Saccharomyces cerevisiae lead to either loss of functionality or terbinafine sensitivity. Biochem Soc Trans 33(Pt 5):1197-201
RNA Levels and Processing Techniques and Reagents	Krantz M, et al. (2004) Anaerobicity prepares Saccharomyces cerevisiae cells for faster adaptation to osmotic shock. Eukaryot Cell 3(6):1381-90	|ALD2 |ALD3 |ALD4 |ALD6 |CTT1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |ERG26 |MORE
Cellular Location Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Mullner H, et al. (2004) Targeting of proteins involved in sterol biosynthesis to lipid particles of the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1663(1-2):9-13	|ERG6 |ERG7
Genomic expression study RNA Levels and Processing Regulation of	Parveen M, et al. (2004) Response of Saccharomyces cerevisiae to a monoterpene: evaluation of antifungal potential by DNA microarray analysis. J Antimicrob Chemother 54(1):46-55	|AAD6 |ADH5 |ADH7 |ADY2 |AGA2 |AMS1 |ARG1 |ARN2 |ATF2 |ATX1 |BCK1 |BFR1 |BSC1 |BUD7 |MORE
Cellular Location Genetic Interactions	Sorger D, et al. (2004) A yeast strain lacking lipid particles bears a defect in ergosterol formation. J Biol Chem 279(30):31190-6	|ARE1 |ARE2 |AYR1 |DGA1 |ERG6 |ERG7 |LRO1
Fungal Related Genes/Proteins	Tsai HF, et al. (2004) Candida glabrata erg1 mutant with increased sensitivity to azoles and to low oxygen tension. Antimicrob Agents Chemother 48(7):2483-9
Regulation of Transcription	Agarwal AK, et al. (2003) Genome-wide expression profiling of the response to polyene, pyrimidine, azole, and echinocandin antifungal agents in Saccharomyces cerevisiae. J Biol Chem 278(37):34998-5015	|AGA1 |AMS1 |ATF2 |AUS1 |BAG7 |BAP2 |BAP3 |CRH1 |CTR1 |CWP1 |CYB5 |DAN1 |DAN4 |ELO1 |MORE
Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Klobucnikova V, et al. (2003) Terbinafine resistance in a pleiotropic yeast mutant is caused by a single point mutation in the ERG1 gene. Biochem Biophys Res Commun 309(3):666-71
Mutants/Phenotypes Protein Sequence Features RNA Levels and Processing Strains/Constructs Substrates/Ligands/Cofactors	Leber R, et al. (2003) Molecular mechanism of terbinafine resistance in Saccharomyces cerevisiae. Antimicrob Agents Chemother 47(12):3890-900
Protein Physical Properties Techniques and Reagents	Peng J, et al. (2003) A proteomics approach to understanding protein ubiquitination. Nat Biotechnol 21(8):921-6	|ACS2 |ADE13 |AKL1 |ALD6 |ARO10 |BSD2 |CCT8 |CDC48 |CHD1 |CHS3 |CIT2 |COS4 |CSR2 |CTR9 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Rosenfeld E, et al. (2003) Oxygen consumption by anaerobic Saccharomyces cerevisiae under enological conditions: effect on fermentation kinetics. Appl Environ Microbiol 69(1):113-21	|OLE1
Function/Process Mutants/Phenotypes Strains/Constructs	Veen M, et al. (2003) Combined overexpression of genes of the ergosterol biosynthetic pathway leads to accumulation of sterols in Saccharomyces cerevisiae. FEMS Yeast Res 4(1):87-95	|ERG11 |HMG1
RNA Levels and Processing Regulation of	Lombardia LJ, et al. (2002) Genome-wide analysis of yeast transcription upon calcium shortage. Cell Calcium 32(2):83-91	|ANR2 |APP1 |ARC40 |BAP3 |BDF1 |BIO4 |CDC14 |CDC24 |CDC6 |CHS6 |CIS3 |CPA1 |CPA2 |CSM3 |MORE
DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Regulation of Substrates/Ligands/Cofactors Transcription	Leber R, et al. (2001) A novel sequence element is involved in the transcriptional regulation of expression of the ERG1 (squalene epoxidase) gene in Saccharomyces cerevisiae. Eur J Biochem 268(4):914-24	|CYC1
Cellular Location Function/Process	Pichler H, et al. (2001) A subfraction of the yeast endoplasmic reticulum associates with the plasma membrane and has a high capacity to synthesize lipids. Eur J Biochem 268(8):2351-61	|ERG6 |ERG9
Reviews	Zweytick D, et al. (2000) Intracellular lipid particles of eukaryotic cells. Biochim Biophys Acta 1469(2):101-20	|AYR1 |EHT1 |ERG6 |ERG7 |FAA1 |FAA4 |FAT1 |NUS1 |PET10 |SLC1 |TDH1 |TDH2 |TDH3 |TGL1 |MORE
Cellular Location	Athenstaedt K, et al. (1999) Identification and characterization of major lipid particle proteins of the yeast Saccharomyces cerevisiae. J Bacteriol 181(20):6441-8	|EHT1 |ERG6 |ERG7 |FAA1 |FAA4 |FAT1 |NUS1 |PET10 |TGL1 |TGL3 |YJU3 |YOR059C
Genomic expression study Regulation of	Dimster-Denk D, et al. (1999) Comprehensive evaluation of isoprenoid biosynthesis regulation in Saccharomyces cerevisiae utilizing the Genome Reporter Matrix. J Lipid Res 40(5):850-60	|ARE1 |ARE2 |BEM1 |BET2 |BET4 |BTS1 |CAT5 |CDC43 |COQ1 |COQ2 |COQ3 |COQ6 |COX10 |ERG10 |MORE
Non-Fungal Related Genes/Proteins	Schafer UA, et al. (1999) An example of intron junctional sliding in the gene families encoding squalene monooxygenase homologues in Arabidopsis thaliana and Brassica napus. Plant Mol Biol 39(4):721-8
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Genetic Interactions	Gachotte D, et al. (1998) Characterization of the Saccharomyces cerevisiae ERG26 gene encoding the C-3 sterol dehydrogenase (C-4 decarboxylase) involved in sterol biosynthesis. Proc Natl Acad Sci U S A 95(23):13794-9	|ERG25 |ERG26 |HEM3
Cellular Location Mutants/Phenotypes Regulation of Strains/Constructs Techniques and Reagents	Leber R, et al. (1998) Dual localization of squalene epoxidase, Erg1p, in yeast reflects a relationship between the endoplasmic reticulum and lipid particles. Mol Biol Cell 9(2):375-86	|ERG6 |KAR2
Other Features	Swan TM and Watson K (1998) Stress tolerance in a yeast sterol auxotroph: role of ergosterol, heat shock proteins and trehalose. FEMS Microbiol Lett 169(1):191-7
Cross-species Expression DNA/RNA Sequence Features Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Favre B and Ryder NS (1997) Cloning and expression of squalene epoxidase from the pathogenic yeast Candida albicans. Gene 189(1):119-26
Mapping Mutants/Phenotypes Strains/Constructs	Landl KM, et al. (1996) ERG1, encoding squalene epoxidase, is located on the right arm of chromosome VII of Saccharomyces cerevisiae. Yeast 12(6):609-13	|ADE3 |QCR9
Function/Process Protein Physical Properties	Barrett-Bee K and Dixon G (1995) Ergosterol biosynthesis inhibition: a target for antifungal agents. Acta Biochim Pol 42(4):465-79	|ERG11 |ERG2 |ERG24 |ERG3
Reviews	Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6	|ERG11 |ERG2 |ERG24 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG9 |FEN1 |FEN2
Reviews	Parks LW and Casey WM (1995) Physiological implications of sterol biosynthesis in yeast. Annu Rev Microbiol 49:95-116	|ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG8 |MORE
Reviews	Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30	|ERG10 |ERG11 |ERG12 |ERG2 |ERG20 |ERG24 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG8 |ERG9 |HMG1 |MORE
Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Physical Properties	Satoh T, et al. (1993) Enzymatic properties of squalene epoxidase from Saccharomyces cerevisiae. Biol Pharm Bull 16(4):349-52
Mutants/Phenotypes	Casey WM, et al. (1992) Regulation of partitioned sterol biosynthesis in Saccharomyces cerevisiae. J Bacteriol 174(22):7283-8	|HEM1 |HMG1 |HMG2
Reviews	Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|ACC1 |ACH1 |CDS1 |CHO1 |CHO2 |CKI1 |CTR1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |MORE
DNA/RNA Sequence Features Mapping Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Jandrositz A, et al. (1991) The gene encoding squalene epoxidase from Saccharomyces cerevisiae: cloning and characterization. Gene 107(1):155-60
Reviews	Ryder NS (1991) Squalene epoxidase as a target for the allylamines. Biochem Soc Trans 19(3):774-7
Function/Process Regulation of	M'Baya B, et al. (1989) Regulation of squalene synthetase and squalene epoxidase activities in Saccharomyces cerevisiae. Lipids 24(12):1020-3	|MVD1
Cellular Location Function/Process Regulation of Substrates/Ligands/Cofactors Techniques and Reagents Transcription	M'Baya B and Karst F (1987) In vitro assay of squalene epoxidase of Saccharomyces cerevisiae. Biochem Biophys Res Commun 147(2):556-64
Cellular Location Regulation of	Jahnke L and Klein HP (1983) Oxygen requirements for formation and activity of the squalene epoxidase in Saccharomyces cerevisiae. J Bacteriol 155(2):488-92
Function/Process Protein Physical Properties Substrates/Ligands/Cofactors	Hata S, et al. (1982) Effect of detergents on sterol synthesis in a cell-free system of yeast. J Lipid Res 23(6):803-10	|ERG6 |ERG9
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Karst F and Lacroute F (1977) Ertosterol biosynthesis in Saccharomyces cerevisiae: mutants deficient in the early steps of the pathway. Mol Gen Genet 154(3):269-77	|ERG10 |ERG11 |ERG12 |ERG7 |ERG8 |ERG9
Other Features	Karst F and Jund R (1976) Sterol replacement in saccharomyces cerevisiae. Effect on cellular permeability and sensitivity to nystatin. Biochem Biophys Res Commun 71(2):535-43	|FCY1
Regulation of	Shimizu I and Katsuki H (1975) Effect of temperature on ergosterol biosynthesis in yeast. J Biochem 77(5):1023-7	|ERG10 |ERG11 |ERG13 |ERG4 |HMG1 |HMG2
Other Features	Karst F and Lacroute F (1974) Yeast mutant requiring only a sterol as growth supplement. Biochem Biophys Res Commun 59(1):370-6

Return to SGD

Send a Message to the SGD Curators