CHO2/YGR157W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrVII: 802445 to 805054
CDS: 802445 - 805054

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

CHO2 YGR157W PEM1 ORF, Verified S000003389

Description
Phosphatidylethanolamine methyltransferase (PEMT), catalyzes the first step in the conversion of phosphatidylethanolamine to phosphatidylcholine during the methylation pathway of phosphatidylcholine biosynthesis

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
methyltransferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0489
Assigned on 2007-05-23 UniProtKB
phosphatidylethanolamine N-methyltransferase activity Kodaki T and Yamashita S (1987) Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes. J Biol Chem 262(32):15428-35
     IDA : Inferred from Direct Assay
Assigned on 2005-08-04 SGD
Summers EF, et al. (1988) Saccharomyces cerevisiae cho2 mutants are deficient in phospholipid methylation and cross-pathway regulation of inositol synthesis. Genetics 120(4):909-22
     IMP : Inferred from Mutant Phenotype
Assigned on 2005-08-04 SGD
Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   TAS : Traceable Author Statement
Assigned on 2003-01-14 SGD
GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
     IEA : Inferred from Electronic Annotation with IUBMB:2.1.1.17
Assigned on 2007-05-23 UniProtKB
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
phosphatidylcholine biosynthetic process Kodaki T and Yamashita S (1987) Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes. J Biol Chem 262(32):15428-35
     IDA : Inferred from Direct Assay
Assigned on 2005-08-04 SGD
Summers EF, et al. (1988) Saccharomyces cerevisiae cho2 mutants are deficient in phospholipid methylation and cross-pathway regulation of inositol synthesis. Genetics 120(4):909-22
     IMP : Inferred from Mutant Phenotype
Assigned on 2005-08-04 SGD
Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   TAS : Traceable Author Statement
Assigned on 2001-01-19 SGD
phospholipid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0594
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   TAS : Traceable Author Statement
Assigned on 2001-01-19 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
phosphatidic acid and phospholipid biosynthesis
phospholipid biosynthesis
superpathway of phospholipid biosynthesis

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forCHO2/YGR157W for CHO2
1) Kodaki T and Yamashita S (1987) Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes. J Biol Chem 262(32):15428-35

2) Kodaki T and Yamashita S (1989) Characterization of the methyltransferases in the yeast phosphatidylethanolamine methylation pathway by selective gene disruption. Eur J Biochem 185(2):243-51

3) Summers EF, et al. (1988) Saccharomyces cerevisiae cho2 mutants are deficient in phospholipid methylation and cross-pathway regulation of inositol synthesis. Genetics 120(4):909-22

4) Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for CHO2/YGR157W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for CHO2/YGR157W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSSCKTT

C-term QTLDSLA

Length(aa) 869

MW(Da) 101,203

pI 8.56

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.106

Codon Adaptation Index 0.170

Frequency of Optimal Codons 0.482

Hydropathicity of Protein -0.037

Aromaticity Score 0.152

10 20 30 40 50 | | | | | MSSCKTTLSEMVGSVTKDRGTINVEARTRSSNVTFKPPVTHDMVRSLFDP TLKKSLLEKCIALAIISNFFICYWVFQRFGLQFTKYFFLVQYLFWRIAYN LGIGLVLHYQSHYETLTNCAKTHAIFSKIPQNKDANSNFSTNSNSFSEKF WNFIRKFCQYEIRSKMPKEYDLFAYPEEINVWLIFRQFVDLILMQDFVTY IIYVYLSIPYSWVQIFNWRSLLGVILILFNIWVKLDAHRVVKDYAWYWGD FFFLEESELIFDGVFNISPHPMYSIGYLGYYGLSLICNDYKVLLVSVFGH YSQFLFLKYVENPHIERTYGDGTDSDSQMNSRIDDLISKENYDYSRPLIN MGLSFNNFNKLRFTDYFTIGTVAALMLGTIMNARFINLNYLFITVFVTKL VSWLFISTILYKQSQSKWFTRLFLENGYTQVYSYEQWQFIYNYYLVLTYT LMIIHTGLQIWSNFSNINNSQLIFGLILVALQTWCDKETRLAISDFGWFY GDFFLSNYISTRKLTSQGIYRYLNHPEAVLGVVGVWGTVLMTNFAVTNII LAVLWTLTNFILVKFIETPHVNKIYGKTKRVSGVGKTLLGLKPLRQVSDI VNRIENIIIKSLVDESKNSNGGAELLPKNYQDNKEWNILIQEAMDSVATR LSPYCELKIENEQVETNFVLPTPVTLNWKMPIELYNGDDWIGLYKVIDTR ADREKTRVGSGGHWSATSKDSYMNHGLRHKESVTEIKATEKYVQGKVTFD TSLLYFENGIYEFRYHSGNSHKVLLISTPFEISLPVLNTTTPELFEKDLT EFLTKVNVLKDGKFRPLGNKFFGMDSLKQLIKNSIGVELSSEYMRRVNGD AHVISHRAWDIKQTLDSLA*

Protein Structures from PDB: proteins of known structure with sequence similarity to CHO2/YGR157W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
CHO2 Summers EF, et al. (1988) Saccharomyces cerevisiae cho2 mutants are deficient in phospholipid methylation and cross-pathway regulation of inositol synthesis. Genetics 120(4):909-22

Alias Name(s) Reference
PEM1 Kodaki T and Yamashita S (1987) Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes. J Biol Chem 262(32):15428-35

Kodaki T and Yamashita S (1989) Characterization of the methyltransferases in the yeast phosphatidylethanolamine methylation pathway by selective gene disruption. Eur J Biochem 185(2):243-51

Standard Name	Reference
CHO2	*Summers EF, et al.* (1988)** Saccharomyces cerevisiae cho2 mutants are deficient in phospholipid methylation and cross-pathway regulation of inositol synthesis. Genetics 120(4):909-22

Alias Name(s)	Reference
PEM1	Kodaki T and Yamashita S (1987) Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes. J Biol Chem 262(32):15428-35 Kodaki T and Yamashita S (1989) Characterization of the methyltransferases in the yeast phosphatidylethanolamine methylation pathway by selective gene disruption. Eur J Biochem 185(2):243-51

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YGR157W SGD Systematic Sequence

853061 NCBI: Gene ID

NP_011673.1 NCBI: RefSeq protein version ID

NP_011673.1 NCBI: RefSeq protein version ID

6321596 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YGR157W	SGD Systematic Sequence
853061	NCBI: Gene ID
NP_011673.1	NCBI: RefSeq protein version ID
NP_011673.1	NCBI: RefSeq protein version ID
6321596	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
76 curated references; 0 references not yet curated
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
He X, et al. (2010) Prevalent positive epistasis in Escherichia coli and Saccharomyces cerevisiae metabolic networks. Nat Genet
       |ACT1 |ALG7 |AVO1 |CCT2 |EOS1 |GAA1 |GAS1 |GUK1 |MET22 |NUP60 |NUS1 |RPC10 |RPL14A |RPS5 |MORE
Alias
Protein Processing/Modification/Regulation
Regulation of
Annan RB, et al. (2009) A biochemical genomics screen for substrates of Ste20p kinase enables the in silico prediction of novel substrates. PLoS One 4(12):e8279
             |ALY2 |BMS1 |BNI1 |BUD6 |CDC10 |CDC3 |CLA4 |COG4 |HTB2 |MYO3 |MYO5 |RAD53 |RPT5 |RSC6 |MORE
Mutants/Phenotypes
Strains/Constructs
Burston HE, et al. (2009) Regulators of yeast endocytosis identified by systematic quantitative analysis. J Cell Biol 185(6):1097-110
       |ABP1 |ADE12 |AIM21 |AIP1 |APL1 |ARC18 |ATG20 |BBC1 |BZZ1 |CAP1 |CAP2 |CHC1 |CLC1 |CRN1 |MORE
Reviews
Eide DJ (2009) Homeostatic and Adaptive Responses to Zinc Deficiency in Saccharomyces cerevisiae. J Biol Chem 284(28):18565-9
       |ADH1 |ADH2 |ADH3 |ADH4 |CHO1 |CKI1 |CTT1 |DPP1 |EKI1 |FET4 |HPF1 |MCD4 |MET14 |MET16 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Garbarino J, et al. (2009) Sterol and diacylglycerol acyltransferase deficiency triggers fatty acid-mediated cell death. J Biol Chem 284(45):30994-1005
       |ARE1 |ARE2 |BFR1 |DGA1 |DGK1 |GET1 |GET2 |GET3 |ICE2 |LRO1 |OPI3 |RDL1 |SFB2 |TSC3
Reviews
Petrossian T and Clarke S (2009) Bioinformatic identification of novel methyltransferases Epigenomics 1(1):163-175
   |ABD1 |ABP140 |AML1 |BIO2 |BUD23 |COQ3 |COQ5 |CRG1 |CTM1 |DIM1 |DOT1 |DPH5 |ELP3 |EMG1 |MORE
Alias
Reviews
Riekhof WR and Voelker DR (2009) The yeast plasma membrane P(4)-ATPases are major transporters for lysophospholipids. Biochim Biophys Acta 1791(7):620-7
       |CDC50 |CHO1 |DNF1 |DNF2 |DNF3 |DRS2 |LEM3 |NEO1 |OPI3 |PDS1 |RET1 |YNR048W
Regulation of
Transcription
Vachova L, et al. (2009) Metabolic diversification of cells during the development of yeast colonies. Environ Microbiol 11(2):494-504
         |ADY2 |ARG1 |ARG3 |ATO2 |ATO3 |CAT2 |CCW12 |CHA1 |CHO1 |CIT2 |CIT3 |CTR1 |CTT1 |DAL7 |MORE
Genetic Interactions
Addinall SG, et al. (2008) A Genomewide Suppressor and Enhancer Analysis of cdc13-1 Reveals Varied Cellular Processes Influencing Telomere Capping in Saccharomyces cerevisiae. Genetics 180(4):2251-66
       |APQ12 |ARC18 |ARV1 |ASC1 |ASE1 |BFA1 |BIM1 |BMH1 |BRE2 |BUB1 |BUB2 |BUB3 |BUD27 |CCS1 |MORE
Strains/Constructs
Deng L, et al. (2008) Manipulation of major membrane lipid synthesis and its effects on sporulation in Saccharomyces cerevisiae. Biosci Biotechnol Biochem 72(9):2362-8
       |ERG7 |MUQ1 |OPI3 |PSD1 |PSD2
Genetic Interactions
Federovitch CM, et al. (2008) Genetic and structural analysis of Hmg2p-induced endoplasmic reticulum remodeling in Saccharomyces cerevisiae. Mol Biol Cell 19(10):4506-20
       |BNI1 |BNR1 |ERG28 |ERV25 |HER1 |HER2 |HMG1 |HMG2 |HOF1 |HRD1 |KAR2 |NEM1 |OPI3 |PSD1 |MORE
Genetic Interactions
Frederick RL, et al. (2008) Multiple pathways influence mitochondrial inheritance in budding yeast. Genetics 178(2):825-37
       |AAH1 |AEP1 |AIM11 |APP1 |ARO8 |ATP1 |ATP10 |ATP12 |ATP7 |BRE5 |CCE1 |COQ5 |COX19 |CYT2 |MORE
Genetic Interactions
Mutants/Phenotypes
Han GS, et al. (2008) An unconventional diacylglycerol kinase that regulates phospholipid synthesis and nuclear membrane growth. J Biol Chem 283(29):20433-42
       |CDS1 |DGK1 |GAT2 |NEM1 |OPI3 |PAH1 |PSD1 |SPO7
Mutants/Phenotypes
Strains/Constructs
Malanovic N, et al. (2008) S-Adenosyl-L-homocysteine Hydrolase, Key Enzyme of Methylation Metabolism, Regulates Phosphatidylcholine Synthesis and Triacylglycerol Homeostasis in Yeast: IMPLICATIONS FOR HOMOCYSTEINE AS A RISK FACTOR OF ATHEROSCLEROSIS. J Biol Chem 283(35):23989-99
       |INO1 |OPI1 |OPI3 |SAH1
Reviews
Nagy PD (2008) Yeast as a model host to explore plant virus-host interactions. Annu Rev Phytopathol 46:217-42
       |ADA2 |DED1 |ERG25 |ERG4 |FAS2 |INO2 |LSM1 |MCT1 |NGL2 |OLE1 |PAT1 |POX1 |SIN3 |SNF6 |MORE
RNA Levels and Processing
Regulation of
Nunez LR, et al. (2008) Cell wall integrity MAPK pathway is essential for lipid homeostasis. J Biol Chem 283(49):34204-17
       |BCK1 |BGL2 |CCW14 |CHS6 |CHS7 |CKI1 |CRH1 |FLC2 |GFA1 |GIC2 |HSP150 |IME2 |INO1 |INO2 |MORE
Alias
Cross-species Expression
Mutants/Phenotypes
Strains/Constructs
Reynolds JM, et al. (2008) Biochemical and Genetic Analysis of the Phosphoethanolamine Methyltransferase of the Human Malaria Parasite Plasmodium falciparum. J Biol Chem 283(12):7894-900
     |OPI3
Reviews
Sugimoto H, et al. (2008) Transcriptional regulation of phosphatidylcholine biosynthesis. Prog Lipid Res 47(3):204-20
       |CDS1 |CHO1 |CPT1 |EPT1 |INO1 |INO2 |INO4 |OPI1 |OPI3 |PSD1 |PSD2
Function/Process
Mutants/Phenotypes
Strains/Constructs
Tanaka K, et al. (2008) Incorporation and remodeling of extracellular phosphatidylcholine with short acyl residues in Saccharomyces cerevisiae. Biochim Biophys Acta 1781(8):391-9
       |ALE1 |OPI3 |PLB1 |PLB2 |PLB3
Reviews
Carman GM and Han GS (2007) Regulation of phospholipid synthesis in Saccharomyces cerevisiae by zinc depletion. Biochim Biophys Acta 1771(3):322-30
       |CDS1 |CHO1 |CKI1 |CPT1 |CRD1 |DPP1 |EKI1 |EPT1 |INM1 |INO1 |OPI1 |OPI3 |PAH1 |PCT1 |MORE
Regulation of
Transcription
Feddersen S, et al. (2007) Transcriptional regulation of phospholipid biosynthesis is linked to fatty acid metabolism by an acyl-CoA-binding-protein-dependent mechanism in Saccharomyces cerevisiae. Biochem J 407(2):219-230
       |ACB1 |ACC1 |CHO1 |CTT1 |DDR2 |FAS1 |FAS2 |GPD1 |HNM1 |HSP12 |INO1 |ITR1 |OLE1 |OPI1 |MORE
Alias
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Riekhof WR, et al. (2007) Lysophosphatidylcholine metabolism in Saccharomyces cerevisiae: the role of P-type ATPases in transport and a broad specificity acyltransferase in acylation. J Biol Chem 282(51):36853-61
       |ALE1 |DNF1 |DNF2 |LEM3 |NTE1 |OPI3
DNA/RNA Sequence Features
RNA Levels and Processing
Regulation of
Wang D, et al. (2007) Expression evolution in yeast genes of single-input modules is mainly due to changes in trans-acting factors. Genome Res 17(8):1161-9
       |ADH6 |AFG1 |APP1 |ARG8 |BNA2 |CAR2 |CRP1 |DIS3 |DYN1 |EMP24 |ERS1 |GPM1 |HEM1 |HMG1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Boumann HA, et al. (2006) Depletion of phosphatidylcholine in yeast induces shortening and increased saturation of the lipid acyl chains: evidence for regulation of intrinsic membrane curvature in a eukaryote. Mol Biol Cell 17(2):1006-17
       |OLE1 |OPI3 |SPO14
Reviews
Choi JY, et al. (2006) Macromolecular assemblies regulate nonvesicular phosphatidylserine traffic in yeast. Biochem Soc Trans 34(Pt 3):404-8
       |CHO1 |MET30 |MET4 |OPI3 |PSD1 |PSD2 |STT4
Function/Process
Mutants/Phenotypes
Strains/Constructs
Gatbonton T, et al. (2006) Telomere length as a quantitative trait: genome-wide survey and genetic mapping of telomere length-control genes in yeast. PLoS Genet 2(3):e35
         |AHC2 |APN1 |ARD1 |ARF1 |ATC1 |ATG17 |BRE1 |BUD21 |CBC2 |CDC73 |CTF8 |CYC8 |DCC1 |DIG1 |MORE
Function/Process
Mutants/Phenotypes
Hancock LC, et al. (2006) Genomic analysis of the Opi- phenotype. Genetics 173(2):621-34
       |AGE2 |ALG9 |APL5 |APL6 |APM3 |APS3 |ARC18 |BSD2 |CKB2 |DEP1 |DID4 |EAF1 |EAF3 |EAF5 |MORE
Reviews
Howe AG and McMaster CR (2006) Regulation of phosphatidylcholine homeostasis by Sec14. Can J Physiol Pharmacol 84(1):29-38
           |CKI1 |CPT1 |EPT1 |INO1 |NTE1 |OPI1 |OPI3 |PCT1 |PLB1 |SCS2 |SEC14 |SPO14
RNA Levels and Processing
Regulation of
Taverna SD, et al. (2006) Yng1 PHD finger binding to H3 trimethylated at K4 promotes NuA3 HAT activity at K14 of H3 and transcription at a subset of targeted ORFs. Mol Cell 24(5):785-96
         |EAF6 |HHT1 |HHT2 |IDI1 |MFT1 |NTO1 |SAS3 |TAF14 |YNG1
Alias
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Gohil VM, et al. (2005) Synthetic lethal interaction of the mitochondrial phosphatidylethanolamine and cardiolipin biosynthetic pathways in Saccharomyces cerevisiae. J Biol Chem 280(42):35410-6
         |CRD1 |DPL1 |OPI3 |PSD1 |PSD2
Cross-species Expression
Function/Process
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Pessi G, et al. (2005) In vivo evidence for the specificity of Plasmodium falciparum phosphoethanolamine methyltransferase and its coupling to the Kennedy pathway. J Biol Chem 280(13):12461-6
       |OPI3 |PCT1
RNA Levels and Processing
Techniques and Reagents
Ronald J, et al. (2005) Simultaneous genotyping, gene-expression measurement, and detection of allele-specific expression with oligonucleotide arrays. Genome Res 15(2):284-91
           |CIS3 |HSP150 |MOG1 |TIP1 |YHR032W
Disease Gene Related
Function/Process
Mutants/Phenotypes
Strains/Constructs
Serviene E, et al. (2005) Genome-wide screen identifies host genes affecting viral RNA recombination. Proc Natl Acad Sci U S A 102(30):10545-50
       |CTL1 |DCI1 |HUR1 |IPK1 |KEM1 |MET22 |PEP7 |SPE3 |SPT3 |UBP3
Cellular Location
Techniques and Reagents
Zybailov B, et al. (2005) Correlation of relative abundance ratios derived from Peptide ion chromatograms and spectrum counting for quantitative proteomic analysis using stable isotope labeling. Anal Chem 77(19):6218-24
       |ADP1 |ARG4 |COT1 |EMP70 |HMG1 |IST2 |ITR1 |LEU1 |PDR10 |PDR15 |SNQ2 |SYG1 |VNX1 |VTC3 |MORE
Mutants/Phenotypes
Protein Physical Properties
Strains/Constructs
Substrates/Ligands/Cofactors
Boumann HA, et al. (2004) The yeast phospholipid N-methyltransferases catalyzing the synthesis of phosphatidylcholine preferentially convert di-C16:1 substrates both in vivo and in vitro. J Biol Chem 279(39):40314-9
       |OPI3
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Choi JY, et al. (2004) Phosphatidylcholine and N-methylated phospholipids are nonessential in Saccharomyces cerevisiae. J Biol Chem 279(40):42321-30
       |OPI3
Function/Process
Iwanyshyn WM, et al. (2004) Regulation of phospholipid synthesis in Saccharomyces cerevisiae by zinc. J Biol Chem 279(21):21976-83
       |ATG8 |CHO1 |INO2 |INO4 |OPI1 |PSD1 |PSD2 |ZRT1 |ZRT2
Genetic Interactions
Strains/Constructs
Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9
           |ARV1 |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |BUD25 |CAX4 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |CNB1 |MORE
Genomic expression study
RNA Levels and Processing
Regulation of
Parveen M, et al. (2004) Response of Saccharomyces cerevisiae to a monoterpene: evaluation of antifungal potential by DNA microarray analysis. J Antimicrob Chemother 54(1):46-55
               |AAD6 |ADH5 |ADH7 |ADY2 |AGA2 |AMS1 |ARG1 |ARN2 |ATF2 |ATX1 |BCK1 |BFR1 |BSC1 |BUD7 |MORE
Mutants/Phenotypes
Strains/Constructs
Roggero R, et al. (2004) Unraveling the mode of action of the antimalarial choline analog G25 in Plasmodium falciparum and Saccharomyces cerevisiae. Antimicrob Agents Chemother 48(8):2816-24
       |CKI1 |CPT1 |EKI1 |EPT1 |HNM1 |MUQ1 |OPI3 |PCT1 |PSD1 |PSD2
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Regulation of
Transcription
Rubin-Bejerano I, et al. (2003) Phagocytosis by neutrophils induces an amino acid deprivation response in Saccharomyces cerevisiae and Candida albicans. Proc Natl Acad Sci U S A 100(19):11007-12
             |ADE1 |ADE12 |ADE13 |ADE16 |ADE17 |ADE2 |ADE3 |ADE4 |ADE5,7 |ADE6 |ADE8 |AKR2 |ALD5 |ARG1 |MORE
Genetic Interactions
Strains/Constructs
Huang D, et al. (2002) Dissection of a complex phenotype by functional genomics reveals roles for the yeast cyclin-dependent protein kinase Pho85 in stress adaptation and cell integrity. Mol Cell Biol 22(14):5076-88
           |ANP1 |BCK1 |BEM1 |BEM2 |BEM4 |BNI1 |BRE1 |CLA4 |CLG1 |EFR3 |ERD1 |FKS1 |FKS3 |GCR1 |MORE
Function/Process
Mutants/Phenotypes
Protein Physical Properties
Strains/Constructs
Janssen MJ, et al. (2002) Cooperative activity of phospholipid-N-methyltransferases localized in different membranes. FEBS Lett 513(2-3):197-202
       |OPI3
Function/Process
Mutants/Phenotypes
Strains/Constructs
Dowd SR, et al. (2001) Turnover of phosphatidylcholine in Saccharomyces cerevisiae. The role of the CDP-choline pathway. J Biol Chem 276(6):3756-63
       |CKI1 |CPT1 |OPI3 |PCT1
Reviews
McMaster CR (2001) Lipid metabolism and vesicle trafficking: more than just greasing the transport machinery. Biochem Cell Biol 79(6):681-92
       |CKI1 |CPT1 |FAB1 |HNM1 |INO2 |INO4 |KES1 |MSS4 |OPI3 |PCT1 |PIK1 |SAC1 |SEC14 |SIT4 |MORE
Protein Sequence Features
Romano JD and Michaelis S (2001) Topological and mutational analysis of Saccharomyces cerevisiae Ste14p, founding member of the isoprenylcysteine carboxyl methyltransferase family. Mol Biol Cell 12(7):1957-71
       |ERG24 |ERG4 |OPI3 |STE14
Non-Fungal Related Genes/Proteins
Bolognese CP and McGraw P (2000) The isolation and characterization in yeast of a gene for Arabidopsis S-adenosylmethionine:phospho-ethanolamine N-methyltransferase. Plant Physiol 124(4):1800-13
       |DIM1 |OPI3
Regulation of
Elkhaimi M, et al. (2000) Combinatorial regulation of phospholipid biosynthetic gene expression by the UME6, SIN3 and RPD3 genes. Nucleic Acids Res 28(16):3160-7
       |CHO1 |INO1 |INO2 |OPI3 |RPD3 |SIN3 |UME6
Function/Process
Substrates/Ligands/Cofactors
Janssen MJ, et al. (2000) The phosphatidylcholine to phosphatidylethanolamine ratio of Saccharomyces cerevisiae varies with the growth phase. Yeast 16(7):641-50
       |CHO1 |INO1 |OPI3
Function/Process
Mutants/Phenotypes
Strains/Constructs
Daum G, et al. (1999) Systematic analysis of yeast strains with possible defects in lipid metabolism. Yeast 15(7):601-14
       |FAS1 |LAP2 |NCP1 |ROG1 |YDL109C
Reviews
Kent C and Carman GM (1999) Interactions among pathways for phosphatidylcholine metabolism, CTP synthesis and secretion through the Golgi apparatus. Trends Biochem Sci 24(4):146-50
       |OPI3 |SEC14
Reviews
Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510
       |ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |ERG1 |MORE
Mutants/Phenotypes
Strains/Constructs
Griac P, et al. (1996) The role of phosphatidylcholine biosynthesis in the regulation of the INO1 gene of yeast. J Biol Chem 271(41):25692-8
       |CPT1 |EPT1 |INO1 |OPI3
Fungal Related Genes/Proteins
Transcription
Jackson JC and Lopes JM (1996) The yeast UME6 gene is required for both negative and positive transcriptional regulation of phospholipid biosynthetic gene expression. Nucleic Acids Res 24(7):1322-9
       |CHO1 |INO1 |INO2 |OPI1 |OPI3 |UME6
DNA/RNA Sequence Features
Mutants/Phenotypes
Strains/Constructs
Koipally J, et al. (1996) Functional characterization of the repeated UASINO element in the promoters of the INO1 and CHO2 genes of yeast. Yeast 12(7):653-65
     |INO1
Fungal Related Genes/Proteins
Mapping
Anderson MS, et al. (1995) Physical map locations of the phospholipid biosynthetic structural and regulatory genes of Saccharomyces cerevisiae. Yeast 11(2):187-90
     |INO1 |OPI3 |PIS1 |UME6
Alias
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Transcription
Kodaki T, et al. (1995) The SNF2/SWI2/GAM1/TYE3/RIC1 gene is involved in the coordinate regulation of phospholipid synthesis in Saccharomyces cerevisiae. J Biochem 117(2):362-8
     |INO1 |OPI3 |SNF2
DNA/RNA Sequence Features
Skala J, et al. (1995) The sequence of a 27 kb segment on the right arm of chromosome VII from Saccharomyces cerevisiae reveals MOL1, NAT2, RPL30B, RSR1, CYS4, PEM1/CHO2, NSR1 genes and ten new open reading frames. Yeast 11(14):1421-7
     |CCM1 |CYS4 |ECL1 |ECM4 |ENP2 |GTO1 |MTR3 |NAT2 |NSR1 |PTI1 |RPL24B |RSR1 |THI4 |YGR149W |MORE
Alias
Fungal Related Genes/Proteins
Transcription
Hosaka K, et al. (1994) Cloning and characterization of the SCS1 gene required for the expression of genes in yeast phospholipid synthesis. J Biochem 115(1):131-6
     |INO1 |INO2 |OPI3 |SCS2
Fungal Related Genes/Proteins
Transcription
Hudak KA, et al. (1994) A pleiotropic phospholipid biosynthetic regulatory mutation in Saccharomyces cerevisiae is allelic to sin3 (sdi1, ume4, rpd1). Genetics 136(2):475-83
     |CHO1 |INO1 |OPI3 |SIN3
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Preitschopf W, et al. (1993) Molecular cloning of the yeast OPI3 gene as a high copy number suppressor of the cho2 mutation. Curr Genet 23(2):95-101
     |CDS1 |INO1 |OPI3
Fungal Related Genes/Proteins
Protein Sequence Features
Gaynor PM and Greenberg ML (1992) Regulation of CDP-diacylglycerol synthesis and utilization by inositol and choline in Schizosaccharomyces pombe. J Bacteriol 174(17):5711-8
       |CHO1
Reviews
Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press
   |ACC1 |ACH1 |CDS1 |CHO1 |CKI1 |CTR1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |MORE
Mutants/Phenotypes
RNA Levels and Processing
Strains/Constructs
Transcription
Gaynor PM, et al. (1991) Regulation of phosphatidylethanolamine methyltransferase and phospholipid methyltransferase by phospholipid precursors in Saccharomyces cerevisiae. Biochim Biophys Acta 1090(3):326-32
     |OPI3
Alias
DNA/RNA Sequence Features
Fungal Related Genes/Proteins
Mutants/Phenotypes
Protein-Nucleic Acid Interactions
Strains/Constructs
Transcription
Kodaki T, et al. (1991) Identification of the upstream activation sequences responsible for the expression and regulation of the PEM1 and PEM2 genes encoding the enzymes of the phosphatidylethanolamine methylation pathway in Saccharomyces cerevisiae. J Biochem 109(2):276-87
     |OPI3
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Protein Physical Properties
Strains/Constructs
Gaynor PM and Carman GM (1990) Phosphatidylethanolamine methyltransferase and phospholipid methyltransferase activities from Saccharomyces cerevisiae. Enzymological and kinetic properties. Biochim Biophys Acta 1045(2):156-63
     |OPI3
Alias
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Kodaki T and Yamashita S (1989) Characterization of the methyltransferases in the yeast phosphatidylethanolamine methylation pathway by selective gene disruption. Eur J Biochem 185(2):243-51
     |OPI3
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
McGraw P and Henry SA (1989) Mutations in the Saccharomyces cerevisiae opi3 gene: effects on phospholipid methylation, growth and cross-pathway regulation of inositol synthesis. Genetics 122(2):317-30
     |INO1 |OPI3
Function/Process
Protein Physical Properties
Chin J and Bloch K (1988) Phosphatidylcholine synthesis in yeast. J Lipid Res 29(1):9-14
       |CKI1 |CPT1 |PCT1
Mutants/Phenotypes
Strains/Constructs
Greenberg ML, et al. (1988) Inositol regulates phosphatidylglycerolphosphate synthase expression in Saccharomyces cerevisiae. Mol Cell Biol 8(11):4773-9
     |OPI1 |OPI3
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Summers EF, et al. (1988) Saccharomyces cerevisiae cho2 mutants are deficient in phospholipid methylation and cross-pathway regulation of inositol synthesis. Genetics 120(4):909-22

Alias
DNA/RNA Sequence Features
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Sequence Features
Strains/Constructs
Kodaki T and Yamashita S (1987) Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes. J Biol Chem 262(32):15428-35
     |OPI3
Fungal Related Genes/Proteins
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Hirsch JP and Henry SA (1986) Expression of the Saccharomyces cerevisiae inositol-1-phosphate synthase (INO1) gene is regulated by factors that affect phospholipid synthesis. Mol Cell Biol 6(10):3320-8
     |INO1 |INO2 |INO4 |OPI1
Alias
Function/Process
Mutants/Phenotypes
Regulation of
Strains/Constructs
Yamashita S, et al. (1982) Regulation of the phosphatidylethanolamine methylation pathway in Saccharomyces cerevisiae. Eur J Biochem 128(2-3):589-95
     |OPI3
Alias
Function/Process
Regulation of
Substrates/Ligands/Cofactors
Yamashita S and Oshima A (1980) Regulation of phosphatidylethanolamine methyltransferase level by myo-inositol in Saccaromyces cerevisiae. Eur J Biochem 104(2):611-6

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.