VMA21/YGR105W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrVII: 698603 to 698836
CDS: 698603 - 698836

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

VMA21 YGR105W ORF, Verified S000003337

Description
Integral membrane protein that is required for vacuolar H+-ATPase (V-ATPase) function, although not an actual component of the V-ATPase complex; functions in the assembly of the V-ATPase; localized to the yeast endoplasmic reticulum (ER)

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-11-13 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
vacuolar proton-transporting V-type ATPase complex assembly Graham LA, et al. (1998) Assembly of the yeast vacuolar H+-ATPase occurs in the endoplasmic reticulum and requires a Vma12p/Vma22p assembly complex. J Cell Biol 142(1):39-49
       IPI : Inferred from Physical Interaction
IMP : Inferred from Mutant Phenotype
Assigned on 2009-04-18 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
cytoplasmic vesicle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0968
Assigned on 2009-06-29 UniProtKB
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
endoplasmic reticulum membrane Graham LA, et al. (1998) Assembly of the yeast vacuolar H+-ATPase occurs in the endoplasmic reticulum and requires a Vma12p/Vma22p assembly complex. J Cell Biol 142(1):39-49
       IDA : Inferred from Direct Assay
Assigned on 2002-11-13 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forVMA21/YGR105W for VMA21
1) Hill KJ and Stevens TH (1994) Vma21p is a yeast membrane protein retained in the endoplasmic reticulum by a di-lysine motif and is required for the assembly of the vacuolar H(+)-ATPase complex. Mol Biol Cell 5(9):1039-50

2) Hirata R, et al. (1993) VMA12 is essential for assembly of the vacuolar H(+)-ATPase subunits onto the vacuolar membrane in Saccharomyces cerevisiae. J Biol Chem 268(2):961-7

3) Graham LA and Stevens TH (1999) Assembly of the yeast vacuolar proton-translocating ATPase. J Bioenerg Biomembr 31(1):39-47

4) Stevens TH and Forgac M (1997) Structure, function and regulation of the vacuolar (H+)-ATPase. Annu Rev Cell Dev Biol 13:779-808

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for VMA21/YGR105W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for VMA21/YGR105W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MAVDVPR

C-term DGNKKED

Length(aa) 77

MW(Da) 8,435

pI 4.91

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.010

Codon Adaptation Index 0.110

Frequency of Optimal Codons 0.425

Hydropathicity of Protein 0.694

Aromaticity Score 0.078

10 20 30 40 50 | | | | | MAVDVPRAVINKLMLFTAAMVVLPVLTFFIIQQFTPNTLISGGLAAAMAN VVLIVYIVVAFREDTEDHKVDGNKKED*

Protein Structures from PDB: proteins of known structure with sequence similarity to VMA21/YGR105W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
VMA21 SGD (2007) Information without a citation in SGD

Standard Name	Reference
VMA21	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YGR105W SGD Systematic Sequence

852997 NCBI: Gene ID

NP_011619.1 NCBI: RefSeq protein version ID

NP_011619.1 NCBI: RefSeq protein version ID

6321542 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YGR105W	SGD Systematic Sequence
852997	NCBI: Gene ID
NP_011619.1	NCBI: RefSeq protein version ID
NP_011619.1	NCBI: RefSeq protein version ID
6321542	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
41 curated references; 0 references not yet curated
Cross-species Expression
Non-Fungal Related Genes/Proteins
Ramachandran N, et al. (2009) VMA21 deficiency causes an autophagic myopathy by compromising V-ATPase activity and lysosomal acidification. Cell 137(2):235-46

Large-scale phenotype analysis
Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508
       |AAT2 |ADO1 |AIM26 |ALG7 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |CSG2 |ELP2 |ERG2 |MORE
Mutants/Phenotypes
Strains/Constructs
Teixeira MC, et al. (2009) Genome-wide identification of Saccharomyces cerevisiae genes required for maximal tolerance to ethanol. Appl Environ Microbiol 75(18):5761-72
       |AGP2 |ANP1 |ARC35 |BDP1 |BNA1 |CSL4 |CUP5 |CWC25 |ERG2 |ERG24 |FHL1 |FPS1 |GCN4 |GCR1 |MORE
Mutants/Phenotypes
Strains/Constructs
Westmoreland TJ, et al. (2009) Comparative genome-wide screening identifies a conserved doxorubicin repair network that is diploid specific in Saccharomyces cerevisiae. PLoS ONE 4(6):e5830
           |AFG3 |AKR1 |ARP5 |BEM1 |CCR4 |CTF4 |CTK1 |DBF2 |DHH1 |ERG3 |HFI1 |HOM6 |HPR1 |LGE1 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Fei W, et al. (2008) Genome-wide analysis of sterol-lipid storage and trafficking in Saccharomyces cerevisiae. Eukaryot Cell 7(2):401-14
       |ARV1 |CAX4 |CDC50 |CNB1 |DRS2 |ERG3 |PLC1 |PTC1 |UME6 |VMA9
Mutants/Phenotypes
Jin YH, et al. (2008) Global transcriptome and deletome profiles of yeast exposed to transition metals. PLoS Genet 4(4):e1000053
         |ADH1 |ARN1 |ARN2 |ATM1 |ATX1 |BCK1 |BNI1 |BSD2 |BUD16 |BUD25 |CCC2 |CKA1 |CKA2 |CKB2 |MORE
Large-scale phenotype analysis
Mutants/Phenotypes
Matsufuji Y, et al. (2008) Acetaldehyde tolerance in Saccharomyces cerevisiae involves the pentose phosphate pathway and oleic acid biosynthesis. Yeast 25(11):825-33
     |ALD3 |ALD6 |AMD1 |ARC1 |ASC1 |BEM4 |BUD27 |CIK1 |COQ3 |CSG2 |ELP2 |ELP3 |GCR2 |GND1 |MORE
Cross-species Expression
Non-Fungal Related Genes/Proteins
Neubert C, et al. (2008) Arabidopsis has two functional orthologs of the yeast V-ATPase assembly factor Vma21p. Traffic 9(10):1618-28

Mutants/Phenotypes
Strains/Constructs
Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67
       |AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Genetic Interactions
Mutants/Phenotypes
Ryan M, et al. (2008) Voa1p functions in V-ATPase assembly in the yeast endoplasmic reticulum. Mol Biol Cell 19(12):5131-42
       |VOA1
Computational analysis
Mutants/Phenotypes
Protein-protein Interactions
Schluter C, et al. (2008) Global Analysis of Yeast Endosomal Transport Identifies the Vps55/68 Sorting Complex. Mol Biol Cell 19(4):1282-1294
       |AKR1 |ARF1 |ARP5 |ARP6 |BRO1 |BUD32 |CDC50 |COG5 |COG6 |COG7 |COG8 |CUP5 |DID4 |EAF1 |MORE
Mutants/Phenotypes
Shima J, et al. (2008) Possible roles of vacuolar H(+)-ATPase and mitochondrial function in tolerance to air-drying stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. Yeast 25(3):179-90
       |ADA2 |ADK1 |ADO1 |AEP2 |AFG3 |ANP1 |APQ13 |ARF1 |ARG82 |ARV1 |ATG17 |ATP17 |BDF1 |BEM1 |MORE
Mutants/Phenotypes
Strains/Constructs
Ando A, et al. (2007) Identification and classification of genes required for tolerance to freeze-thaw stress revealed by genome-wide screening of Saccharomyces cerevisiae deletion strains. FEMS Yeast Res 7(2):244-53
       |AIM4 |AKR1 |ANP1 |BRE1 |BUD19 |CKB2 |CTF4 |CUP5 |DEG1 |DIA2 |EOS1 |ERG24 |FAB1 |GAS1 |MORE
Mutants/Phenotypes
Cheng V, et al. (2007) Genome-Wide Screen for Oxalate-Sensitive Mutants of Saccharomyces cerevisiae. Appl Environ Microbiol 73(18):5919-27
       |ADA2 |AFT1 |CCR4 |CDC40 |CNM67 |CTK3 |DRS2 |ERG2 |ERG24 |GLY1 |GON7 |HOM6 |KEM1 |MCH5 |MORE
Reviews
Kane PM (2007) The long physiological reach of the yeast vacuolar H(+)-ATPase. J Bioenerg Biomembr 39(5-6):415-21
       |CUP5 |PKR1 |PPA1 |STV1 |TFP1 |TFP3 |VMA10 |VMA13 |VMA2 |VMA22 |VMA4 |VMA5 |VMA6 |VMA7 |MORE
Mutants/Phenotypes
Strains/Constructs
Pagani MA, et al. (2007) Disruption of iron homeostasis in Saccharomyces cerevisiae by high zinc levels: a genome-wide study. Mol Microbiol 65(2):521-37
       |ACO1 |ACO2 |ADE1 |ADE12 |ADE13 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADK1 |AFT1 |AKR1 |ARN1 |MORE
Mutants/Phenotypes
Xia L, et al. (2007) Identification of genes required for protection from doxorubicin by a genome-wide screen in Saccharomyces cerevisiae. Cancer Res 67(23):11411-8
       |ADK1 |AFG3 |ARP8 |ASC1 |ASF1 |BEM1 |BEM4 |BUD22 |CCS1 |COX6 |DBP3 |ERG3 |FLX1 |GAS1 |MORE
Protein-protein Interactions
Compton MA, et al. (2006) Vma9p (subunit e) is an integral membrane V0 subunit of the yeast V-ATPase. J Biol Chem 281(22):15312-9
       |PPA2 |STV1 |TFP3 |VMA22 |VMA4 |VMA5 |VMA6 |VMA9 |VPH1 |VPH2
Genetic Interactions
Mutants/Phenotypes
Davis-Kaplan SR, et al. (2006) PKR1 encodes an assembly factor for the yeast V-type ATPase. J Biol Chem 281(42):32025-35
       |PKR1
Evolution
Fungal Related Genes/Proteins
De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81
       |AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Non-Fungal Related Genes/Proteins
Liu X, et al. (2006) Molecular cloning and characterization of a novel V-ATPase associated protein, DVA9.2, from human dendritic cells. Life Sci 79(19):1828-38

Mutants/Phenotypes
Ochotny N, et al. (2006) Effects of Human a3 and a4 Mutations That Result in Osteopetrosis and Distal Renal Tubular Acidosis on Yeast V-ATPase Expression and Activity. J Biol Chem 281(36):26102-11
       |STV1 |VMA22 |VPH1 |VPH2
Mutants/Phenotypes
Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401
       |AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Welsh LM, et al. (2006) Genetic and molecular interactions of the Erv41p-Erv46p complex involved in transport between the endoplasmic reticulum and Golgi complex. J Cell Sci 119(Pt 22):4730-40
         |ERV41 |ERV46 |ROT2 |VMA22 |VPH2 |VPS1
Mutants/Phenotypes
Davis-Kaplan SR, et al. (2004) Genome-wide analysis of iron-dependent growth reveals a novel yeast gene required for vacuolar acidification. J Biol Chem 279(6):4322-9
         |AFT1 |BEM2 |CCC2 |CTR1 |CUP5 |FET3 |FTR1 |GEF1 |PKR1 |VMA2 |VMA8 |VMA9 |VPH2 |YCL007C |MORE
Cellular Location
Function/Process
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Malkus P, et al. (2004) Role of Vma21p in assembly and transport of the yeast vacuolar ATPase. Mol Biol Cell 15(11):5075-91
       |CUP5 |PPA1 |TFP3 |VMA6 |VPH1
Genetic Interactions
Strains/Constructs
Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9
           |ARV1 |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |BUD25 |CAX4 |CHO2 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |MORE
Mutants/Phenotypes
Serrano R, et al. (2004) Copper and iron are the limiting factors for growth of the yeast Saccharomyces cerevisiae in an alkaline environment. J Biol Chem 279(19):19698-704
           |AFT1 |ATX1 |BEM1 |BSD2 |BUD25 |CCC2 |CCS1 |COX17 |CTR1 |CUP5 |DIA2 |ERG2 |ERG6 |FET3 |MORE
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Reviews
Graham LA, et al. (2003) Structure and assembly of the yeast V-ATPase. J Bioenerg Biomembr 35(4):301-12
     |CUP5 |PPA1 |STV1 |TFP1 |TFP3 |VMA10 |VMA13 |VMA2 |VMA22 |VMA4 |VMA5 |VMA6 |VMA7 |VMA8 |MORE
Cellular Location
Protein Physical Properties
Kim H, et al. (2003) Topology models for 37 Saccharomyces cerevisiae membrane proteins based on C-terminal reporter fusions and predictions. J Biol Chem 278(12):10208-13
         |AQY1 |ASG7 |ATO2 |AVT6 |CDC1 |ECM7 |ERP2 |ERV15 |FCY2 |FLD1 |HHY1 |IZH4 |MEP1 |MUP1 |MORE
Mutants/Phenotypes
Strains/Constructs
Ran H, et al. (2003) Human targets of Pseudomonas aeruginosa pyocyanin. Proc Natl Acad Sci U S A 100(24):14315-20
           |BNA2 |BSD2 |BUD30 |CAT5 |CCM1 |CDC50 |CLN2 |COQ1 |DOA4 |ERG24 |FEN1 |FIG2 |GAS1 |GET2 |MORE
Mutants/Phenotypes
Strains/Constructs
Chang M, et al. (2002) A genome-wide screen for methyl methanesulfonate-sensitive mutants reveals genes required for S phase progression in the presence of DNA damage. Proc Natl Acad Sci U S A 99(26):16934-9
           |AAT2 |APN1 |ARO1 |ARO7 |ASF1 |BDF1 |BUD25 |BUR2 |CAC2 |CCS1 |CDC40 |CDC50 |CHL1 |CIK1 |MORE
Function/Process
Mutants/Phenotypes
Dimmer KS, et al. (2002) Genetic basis of mitochondrial function and morphology in Saccharomyces cerevisiae. Mol Biol Cell 13(3):847-53
       |ABF2 |ACO1 |ADA2 |ADK1 |AEP1 |AEP2 |AEP3 |AFG3 |AFT1 |AIM10 |AIM22 |ALY1 |APQ13 |ARG82 |MORE
Reviews
Graham LA, et al. (2000) Composition and assembly of the yeast vacuolar H(+)-ATPase complex. J Exp Biol 203(Pt 1):61-70
       |CUP5 |PPA1 |STV1 |TFP1 |TFP3 |VMA10 |VMA2 |VMA22 |VMA4 |VMA5 |VMA6 |VMA7 |VMA8 |VPH1 |MORE
Cellular Location
Function/Process
Graham LA and Stevens TH (1999) Assembly of the yeast vacuolar proton-translocating ATPase. J Bioenerg Biomembr 31(1):39-47
     |CUP5 |PPA1 |STV1 |TFP1 |TFP3 |VMA10 |VMA13 |VMA2 |VMA22 |VMA4 |VMA5 |VMA6 |VMA7 |VMA8 |MORE
Reviews
Nelson N and Harvey WR (1999) Vacuolar and plasma membrane proton-adenosinetriphosphatases. Physiol Rev 79(2):361-85
       |CUP5 |PPA1 |STV1 |TFP1 |TFP3 |VMA10 |VMA13 |VMA2 |VMA22 |VMA4 |VMA5 |VMA6 |VMA7 |VMA8 |MORE
Cellular Location
Function/Process
Protein Physical Properties
Graham LA, et al. (1998) Assembly of the yeast vacuolar H+-ATPase occurs in the endoplasmic reticulum and requires a Vma12p/Vma22p assembly complex. J Cell Biol 142(1):39-49
       |SEC12 |VMA22 |VPH1 |VPH2
Function/Process
Fungal Related Genes/Proteins
Hill KJ and Stevens TH (1995) Vma22p is a novel endoplasmic reticulum-associated protein required for assembly of the yeast vacuolar H(+)-ATPase complex. J Biol Chem 270(38):22329-36
       |VMA22 |VPH2
Cellular Location
DNA/RNA Sequence Features
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Hill KJ and Stevens TH (1994) Vma21p is a yeast membrane protein retained in the endoplasmic reticulum by a di-lysine motif and is required for the assembly of the vacuolar H(+)-ATPase complex. Mol Biol Cell 5(9):1039-50

Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Ho MN, et al. (1993) Isolation of vacuolar membrane H(+)-ATPase-deficient yeast mutants; the VMA5 and VMA4 genes are essential for assembly and activity of the vacuolar H(+)-ATPase. J Biol Chem 268(1):221-7
     |VMA22 |VMA4 |VMA5

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.