UFD1/YGR048W Single Page Format |
|
Contents
- Names and Identifiers
- GO Annotations
- Pathways
- Summary Paragraph
- Mutant Phenotypes
- Interactions
- Homologs
- Protein Info (physical properties, transcript info)
- PDB Homologs (protein structure info)
- Motifs
- Genome-wide Expression
(and other large-scale analyses)- Locus History (misc. notes)
- Sequence Retrieval and Analysis
- Map and Displays
- Localization
- Community Annotation
- Literature Guide
Sequence Coordinates
  ChrVII: 589830 to 590915
CDS: 589830 - 590915Click on map for expanded view
SGD ORF map GBrowse SGD Locus Page
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Standard Name | Systematic Name | Alias | Feature Type | SGDID | ||||
| UFD1 | YGR048W |   | ORF, Verified | S000003280 | ||||
| Description | ||||||||
| Protein that interacts with Cdc48p and Npl4p, involved in recognition of polyubiquitinated proteins and their presentation to the 26S proteasome for degradation; involved in transporting proteins from the ER to the cytosol | ||||||||
| |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No pathways available | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No summary paragraph available | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
| |||||||
|---|---|---|---|---|---|---|---|
| Phenotype page for UFD1/YGR048W | |||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Interaction page for UFD1/YGR048W | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 10 20 30 40 50
| | | | |
MFSGFSSFGGGNGFVNMPQTFEEFFRCYPIAMMNDRIRKDDANFGGKIFL
PPSALSKLSMLNIRYPMLFKLTANETGRVTHGGVLEFIAEEGRVYLPQWM
METLGIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRN
FSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPV
GYVEPDYKALKAQQDKEKKNSFGKGQVLDPSVLGQGSMSTRIDYAGIANS
SRNKLSKFVGQGQNISGKAPKAEPKQDIKDMKITFDGEPAKLDLPEGQLF
FGFPMVLPKEDEESAAGSKSSEQNFQGQGISLRKSNKRKTKSDHDSSKSK
APKSPEVIEID*
| ||||||||||||||||||||||||||||
| ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ||||||||||||||||||||||||||||
| |||||
|---|---|---|---|---|---|
| You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses. | |||||
| ||||
|---|---|---|---|---|
| Nomenclature History |
|---|
| Standard Name | Reference |
|---|---|
| UFD1 | SGD (2007) Information without a citation in SGD |
| Mapping Notes |
| |||||
|---|---|---|---|---|---|
| Sequence Type | Output Format | ||||
| Genomic DNA | GCG | FASTA | NoHeader | ||||
| Genomic DNA with 1 kb up and downstream | GCG | FASTA | NoHeader | ||||
| DNA coding sequence (without introns, without flanking regions) | GCG | FASTA | NoHeader | ||||
| Protein Translation of ORF | GCG | FASTA | NoHeader | ||||
| 6-Frame Translation(with Restriction Map) | GCG | ||||
| Restriction Fragment Sizes | GCG | ||||
| Sequence from other databases | |
|---|---|
| Sequence ID | Source |
| YGR048W | SGD Systematic Sequence |
| 852939 | NCBI: Gene ID |
| NP_011562.1 | NCBI: RefSeq protein version ID |
| NP_011562.1 | NCBI: RefSeq protein version ID |
| 6321485 | NCBI: NCBI protein GI |
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Physical, Genetic Maps: | Chromosomal Feature Map | GBrowse | Combined Physical and Genetic Map | Genetic Distance vs. Physical Distance Ratios | ||||
| Similarity Viewers: | Synteny Viewer | Genomic Stripe View | SAGE Results Map |   | ||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No community annotation available. | |||||||||
| ||||||
|---|---|---|---|---|---|---|
| Topics | Reference | Other Genes Addressed | 59 curated references; 0 references not yet curated | |||
| Function/Process Regulatory Role Strains/Constructs | Bhattacharya S, et al. (2009) Identification of lysines within membrane-anchored Mga2p120 that are targets of Rsp5p ubiquitination and mediate mobilization of tethered Mga2p90. J Mol Biol 385(3):718-25 | |CDC48 |MGA2 |NPL4 |OLE1 |RSP5 |SPT23 | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Bosis E, et al. (2009) Ssz1 Restores ERAD in Cells Expressing Defective Cdc48-Ufd1-Npl4 Complex by Upregulating Cdc48. Genetics | |CDC48 |HMG2 |HRD1 |NPL4 |PDR1 |RPN4 |RPT1 |SSZ1 | ||||
| RNA Levels and Processing | Metzger MB and Michaelis S (2009) Analysis of quality control substrates in distinct cellular compartments reveals a unique role for Rpn4p in tolerating misfolded membrane proteins. Mol Biol Cell 20(3):1006-19 | |ADE17 |ALF1 |CCT3 |CIK1 |DGK1 |ECM29 |GET3 |HAC1 |HRD1 |IDH1 |ITR1 |KAR2 |MAG1 |MIA40 |MORE | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Morgan J, et al. (2009) Altering sphingolipid metabolism in Saccharomyces cerevisiae cells lacking the amphiphysin ortholog Rvs161 reinitiates sugar transporter endocytosis. Eukaryot Cell 8(5):779-89 | |CDC48 |DOA1 |DOA4 |GAL2 |HXT1 |HXT2 |HXT3 |HXT4 |MAL61 |RSP5 |RVS161 |SHP1 |SUC2 |SUR4 | ||||
| Non-Fungal Related Genes/Proteins | Spork S, et al. (2009) An unusual ERAD-like complex is targeted to the apicoplast of Plasmodium falciparum. Eukaryot Cell 8(8):1134-45 | |CDC48 |DER1 |HRD1 |HRD3 |NPL4 |RPL40A |RPL40B |RPS31 |UBA1 |UBA2 |UBC4 |UBI4 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Wang Y, et al. (2009) Abnormal proteins can form aggresome in yeast: aggresome-targeting signals and components of the machinery. FASEB J 23(2):451-63 | |ADH1 |ATP2 |BMH1 |CDC48 |DSK2 |ENO2 |FBA1 |HSP42 |HSP60 |HSP82 |ILV5 |IPP1 |MDR1 |NOG2 |MORE | ||||
| Mutants/Phenotypes Strains/Constructs | Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8 | |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE | ||||
| Cellular Location Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs | Duennwald ML and Lindquist S (2008) Impaired ERAD and ER stress are early and specific events in polyglutamine toxicity. Genes Dev 22(23):3308-3319 | |CDC48 |CUE1 |HAC1 |IRE1 |NPL4 |OLE1 |PMR1 |PRC1 |PRE1 |PRE2 |PRE9 |RAD6 |RPN2 |SEC22 |MORE | ||||
| Protein-protein Interactions | Goder V, et al. (2008) The ER-associated degradation component Der1p and its homolog Dfm1p are contained in complexes with distinct cofactors of the ATPase Cdc48p. FEBS Lett 582(11):1575-80 | |CDC48 |DER1 |DFM1 |HRD1 |HRD3 |KAR2 |NPL4 |SHP1 |UBX2 |UBX7 |USA1 |YOS9 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Kohlmann S, et al. (2008) Ubiquitin Ligase Hul5 Is Required for Fragment-specific Substrate Degradation in Endoplasmic Reticulum-associated Degradation. J Biol Chem 283(24):16374-83 | |CDC48 |HRD1 |HUL5 | ||||
| Mutants/Phenotypes Strains/Constructs | Medicherla B and Goldberg AL (2008) Heat shock and oxygen radicals stimulate ubiquitin-dependent degradation mainly of newly synthesized proteins. J Cell Biol 182(4):663-73 | |CDC48 |NPL4 |RPN10 |SOD1 |SOD2 |UBC4 |UBC5 |UBC7 |UFD4 | ||||
| Protein-protein Interactions | Meednu N, et al. (2008) The Spindle Positioning Protein Kar9p Interacts With the Sumoylation Machinery in Saccharomyces cerevisiae. Genetics 180(4):2033-55 | |BIK1 |BIM1 |CST9 |DYN1 |KAR9 |MYO2 |NFI1 |NIS1 |SIZ1 |SMT3 |STU2 |UBC9 |ULS1 |WSS1 | ||||
| Function/Process Mutants/Phenotypes Substrates/Ligands/Cofactors | Metzger MB, et al. (2008) Degradation of a Cytosolic Protein Requires Endoplasmic Reticulum-associated Degradation Machinery. J Biol Chem 283(47):32302-16 | |CDC48 |CUE1 |HLJ1 |NPL4 |SSA1 |SSM4 |UBC4 |UBC5 |UBC6 |UBC7 |URA3 |YDJ1 | ||||
| RNA Levels and Processing | Trott A, et al. (2008) Activation of Heat Shock and Antioxidant Responses by the Natural Product Celastrol: Transcriptional Signatures of a Thiol-targeted Molecule. Mol Biol Cell 19(3):1104-12 | |AAD14 |AAD15 |AAD16 |AAD3 |AAD4 |AAD6 |ADH5 |ADH6 |AHP1 |ALD3 |ALD4 |ALD6 |ARI1 |ATR1 |MORE | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Braun S and Jentsch S (2007) SM-protein-controlled ER-associated degradation discriminates between different SNAREs. EMBO Rep 8(12):1176-82 | |CDC48 |SED5 |SLY1 |UBC6 |UBC7 |UFE1 | ||||
| Protein-protein Interactions Regulation of Strains/Constructs | Shcherbik N and Haines DS (2007) Cdc48p(Npl4p/Ufd1p) binds and segregates membrane-anchored/tethered complexes via a polyubiquitin signal present on the anchors. Mol Cell 25(3):385-97 | |CDC48 |MGA2 |NPL4 |RSP5 |SPT23 | ||||
| Other Features Regulation of Transcription | Auld KL, et al. (2006) The Conserved ATPase Get3/Arr4 Modulates the Activity of Membrane-Associated Proteins in Saccharomyces cerevisiae. Genetics 174(1):215-27 | |CDC48 |GET1 |GET2 |GET3 |NPL4 | ||||
| Mutants/Phenotypes | Heiligenstein S, et al. (2006) Retrotranslocation of a viral A/B toxin from the yeast endoplasmic reticulum is independent of ubiquitination and ERAD. EMBO J 25(20):4717-27 | |CDC48 |DSK2 |HRD1 |JEM1 |KAR2 |NPL4 |PDI1 |PMR1 |RAD23 |RSP5 |SCJ1 |SPF1 |UBC1 |UBC4 |MORE | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Liao M, et al. (2006) Endoplasmic reticulum-associated degradation of cytochrome P450 CYP3A4 in Saccharomyces cerevisiae: further characterization of cellular participants and structural determinants. Mol Pharmacol 69(6):1897-904 | |CDC48 |CUE1 |HRD1 |HRD3 |NPL4 |PEP4 |RPN1 |RSP5 |SSM4 |UBC6 |UBC7 | ||||
| Protein Processing/Modification/Regulation | Mirzaei H and Regnier F (2006) Enrichment of carbonylated peptides using Girard P reagent and strong cation exchange chromatography. Anal Chem 78(3):770-8 | |ALA1 |ATP1 |AVL9 |AVO1 |AYT1 |CAF16 |CBS2 |CCT3 |CHO1 |CIN8 |DOA4 |ERV1 |GCN5 |HSH49 |MORE | ||||
| Reviews | Pety de Thozee C and Ghislain M (2006) ER-associated degradation of membrane proteins in yeast. ScientificWorldJournal 6:967-83 | |CDC48 |NPL4 |SAR1 | ||||
| Mutants/Phenotypes | Ravid T, et al. (2006) Membrane and soluble substrates of the Doa10 ubiquitin ligase are degraded by distinct pathways. EMBO J 25(3):533-43 | |CBF2 |CDC48 |CUE1 |MATALPHA2 |MPS2 |NPL4 |QRI1 |SSM4 |UBC6 | ||||
| Non-Fungal Related Genes/Proteins Reviews | Romisch K (2006) Cdc48p is UBX-linked to ER ubiquitin ligases. Trends Biochem Sci 31(1):24-5 | |CDC48 |DER1 |HRD1 |NPL4 |UBX2 | ||||
| Reviews | Sobko A (2006) Systems biology of AGC kinases in fungi. Sci STKE 2006(352):re9 | |CDC48 |HSF1 |HSP82 |HTB1 |PAB1 |PDC2 |PKH1 |PKH2 |SCH9 |SHP1 |SSE1 |SUP35 |YPK1 |YPK2 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Altmann K and Westermann B (2005) Role of essential genes in mitochondrial morphogenesis in Saccharomyces cerevisiae. Mol Biol Cell 16(11):5410-7 | |ARC35 |ARC40 |ARP2 |BFR2 |CCT4 |CCT6 |CDC34 |CDC53 |COF1 |DSL1 |ERG1 |ERG10 |ERG12 |ERG13 |MORE | ||||
| Reviews | Bazirgan OA and Hampton RY (2005) Cdc48-Ufd2-Rad23: the road less ubiquitinated? Nat Cell Biol 7(3):207-9 | |CDC48 |DSK2 |NPL4 |RAD23 |UFD2 | ||||
| Reviews | Lord JM, et al. (2005) Quality control: another player joins the ERAD cast. Curr Biol 15(23):R963-4 | |CDC48 |DER1 |HRD1 |NPL4 |SSM4 |UBX2 | ||||
| Function/Process Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs | Park S, et al. (2005) Ufd1 exhibits the AAA-ATPase fold with two distinct ubiquitin interaction sites. Structure 13(7):995-1005 | |UBI4 | ||||
| Function/Process Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs | Richly H, et al. (2005) A series of ubiquitin binding factors connects CDC48/p97 to substrate multiubiquitylation and proteasomal targeting. Cell 120(1):73-84 | |CDC48 |DSK2 |NPL4 |RAD23 |RPN10 |SPT23 |UFD2 | ||||
| Cellular Location Mutants/Phenotypes Protein-protein Interactions Strains/Constructs | Schuberth C and Buchberger A (2005) Membrane-bound Ubx2 recruits Cdc48 to ubiquitin ligases and their substrates to ensure efficient ER-associated protein degradation. Nat Cell Biol 7(10):999-1006 | |CDC48 |HRD1 |SSM4 |UBX2 | ||||
| Protein-protein Interactions | Archambault V, et al. (2004) Targeted proteomic study of the cyclin-Cdk module. Mol Cell 14(6):699-711 | |ACE2 |ACM1 |BEM3 |BIK1 |BMH2 |BUD3 |CBK1 |CDC25 |CDC28 |CDC4 |CDC48 |CDC53 |CDC6 |CDH1 |MORE | ||||
| Reviews | Cao K and Zheng Y (2004) The Cdc48/p97-Ufd1-Npl4 complex: its potential role in coordinating cellular morphogenesis during the M-G1 transition. Cell Cycle 3(4):422-4 | |CDC48 |NPL4 | ||||
| Reviews | Cheeseman IM and Desai A (2004) Cell division: AAAtacking the mitotic spindle. Curr Biol 14(2):R70-2 | |ASE1 |CDC48 |NPL4 | ||||
| Function/Process Strains/Constructs | Decottignies A, et al. (2004) Binding of Cdc48p to a ubiquitin-related UBX domain from novel yeast proteins involved in intracellular proteolysis and sporulation. Yeast 21(2):127-39 | |CDC48 |DOA1 |UBX4 |UBX6 |UBX7 | ||||
| Function/Process | Gnann A, et al. (2004) Cystic fibrosis transmembrane conductance regulator degradation depends on the lectins Htm1p/EDEM and the Cdc48 protein complex in yeast. Mol Biol Cell 15(9):4125-35 | |CDC48 |HRD1 |MNL1 |NPL4 |SSM4 | ||||
| Protein-protein Interactions | Mangus DA, et al. (2004) Identification of factors regulating poly(A) tail synthesis and maturation. Mol Cell Biol 24(10):4196-206 | |DIG1 |FIR1 |PAB1 |PAN2 |PAN3 |PBP1 |PBP2 |PBP4 |REF2 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs | Medicherla B, et al. (2004) A genomic screen identifies Dsk2p and Rad23p as essential components of ER-associated degradation. EMBO Rep 5(7):692-7 | |CDC48 |DSK2 |NPL4 |RAD23 | ||||
| Regulation of Transcription | Schade B, et al. (2004) Cold adaptation in budding yeast. Mol Biol Cell 15(12):5492-502 | |DBP2 |DED1 |GLC3 |GLK1 |GPD1 |GPH1 |GPX1 |GTT2 |HAP5 |HRP1 |HSP10 |HSP104 |HSP12 |HSP26 |MORE | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Schuberth C, et al. (2004) Shp1 and Ubx2 are adaptors of Cdc48 involved in ubiquitin-dependent protein degradation. EMBO Rep 5(8):818-24 | |CDC48 |NPL4 |RPN10 |SHP1 |UBX2 |UBX3 |UBX4 |UBX5 |UBX6 |UBX7 | ||||
| Non-Fungal Related Genes/Proteins | Cao K, et al. (2003) The AAA-ATPase Cdc48/p97 regulates spindle disassembly at the end of mitosis. Cell 115(3):355-67 | |ASE1 |CDC48 |CDC5 |CLB2 |NPL4 | ||||
| Fungal Related Genes/Proteins | Naula N, et al. (2003) Cordycepin in Schizosaccharomyces pombe: effects on the wild type and phenotypes of mutants resistant to the drug. Curr Genet 43(6):400-6 | |||||
| Reviews | Schnell JD and Hicke L (2003) Non-traditional functions of ubiquitin and ubiquitin-binding proteins. J Biol Chem 278(38):35857-60 | |CDC48 |CUE1 |MMS2 |NPL4 |RPN10 |RSP5 |STP2 |UBI4 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors | Taxis C, et al. (2003) Use of modular substrates demonstrates mechanistic diversity and reveals differences in chaperone requirement of ERAD. J Biol Chem 278(38):35903-13 | |CDC48 |CWC23 |DER1 |HLJ1 |HRD1 |HRD3 |HSP104 |JID1 |KAR2 |NPL4 |SSA1 |SSA2 |SSA3 |SSA4 |MORE | ||||
| Non-Fungal Related Genes/Proteins Reviews | Woodman PG (2003) p97, a protein coping with multiple identities. J Cell Sci 116(Pt 21):4283-90 | |CDC48 |NPL4 |VPS4 | ||||
| Function/Process Non-Fungal Related Genes/Proteins Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs Substrates/Ligands/Cofactors | Ye Y, et al. (2003) Function of the p97-Ufd1-Npl4 complex in retrotranslocation from the ER to the cytosol: dual recognition of nonubiquitinated polypeptide segments and polyubiquitin chains. J Cell Biol 162(1):71-84 | |CDC48 |NPL4 | ||||
| Function/Process Protein-protein Interactions Reviews Substrates/Ligands/Cofactors | Bays NW and Hampton RY (2002) Cdc48-Ufd1-Npl4: stuck in the middle with Ub. Curr Biol 12(10):R366-71 | |CDC48 |NPL4 | ||||
| Function/Process Protein-protein Interactions Substrates/Ligands/Cofactors | Braun S, et al. (2002) Role of the ubiquitin-selective CDC48(UFD1/NPL4 )chaperone (segregase) in ERAD of OLE1 and other substrates. EMBO J 21(4):615-21 | |CDC48 |NPL4 |OLE1 | ||||
| Cellular Location Function/Process Protein-protein Interactions Substrates/Ligands/Cofactors | Bays NW, et al. (2001) HRD4/NPL4 is required for the proteasomal processing of ubiquitinated ER proteins. Mol Biol Cell 12(12):4114-28 | |CDC48 |NPL4 | ||||
| Function/Process Non-Fungal Related Genes/Proteins | Botta A, et al. (2001) Cloning and characterization of the gene encoding human NPL4, a protein interacting with the ubiquitin fusion-degradation protein (UFD1L). Gene 275(1):39-46 | |NPL4 | ||||
| Cellular Location Function/Process Protein-protein Interactions | Hetzer M, et al. (2001) Distinct AAA-ATPase p97 complexes function in discrete steps of nuclear assembly. Nat Cell Biol 3(12):1086-91 | |NPL4 | ||||
| Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Regulatory Role Strains/Constructs Substrates/Ligands/Cofactors | Hitchcock AL, et al. (2001) The conserved npl4 protein complex mediates proteasome-dependent membrane-bound transcription factor activation. Mol Biol Cell 12(10):3226-41 | |CDC48 |MGA2 |NPL4 |OLE1 |SPT23 | ||||
| Cellular Location Function/Process Protein-protein Interactions Strains/Constructs Substrates/Ligands/Cofactors | Rape M, et al. (2001) Mobilization of processed, membrane-tethered SPT23 transcription factor by CDC48(UFD1/NPL4), a ubiquitin-selective chaperone. Cell 107(5):667-77 | |CDC48 |NPL4 |OLE1 |SPT23 | ||||
| Disease Gene Related Non-Fungal Related Genes/Proteins | Ratti A, et al. (2001) Cloning and molecular characterization of three ubiquitin fusion degradation 1 (Ufd1) ortholog genes from Xenopus laevis, Gallus gallus and Drosophila melanogaster. Cytogenet Cell Genet 92(3-4):279-82 | |||||
| Cellular Location Function/Process Protein-protein Interactions Substrates/Ligands/Cofactors | Ye Y, et al. (2001) The AAA ATPase Cdc48/p97 and its partners transport proteins from the ER into the cytosol. Nature 414(6864):652-6 | |CDC48 |NPL4 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Hoppe T, et al. (2000) Activation of a membrane-bound transcription factor by regulated ubiquitin/proteasome-dependent processing. Cell 102(5):577-86 | |CDC48 |MGA2 |NPL4 |OLE1 |RSP5 |SPT23 | ||||
| Mutants/Phenotypes Strains/Constructs | Entian KD, et al. (1999) Functional analysis of 150 deletion mutants in Saccharomyces cerevisiae by a systematic approach. Mol Gen Genet 262(4-5):683-702 | |ABM1 |AIM3 |ALT1 |AMN1 |APD1 |APL2 |AVT3 |BIO3 |BIO4 |BIO5 |BNA3 |BUD4 |CFD1 |CHA4 |MORE | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Hammerle M, et al. (1998) Proteins of newly isolated mutants and the amino-terminal proline are essential for ubiquitin-proteasome-catalyzed catabolite degradation of fructose-1,6-bisphosphatase of Saccharomyces cerevisiae. J Biol Chem 273(39):25000-5 | |DOA1 |FBP1 |ICL1 |MDH2 |PCK1 |RMD5 |RPN4 |UBC8 |UFD2 |UFD4 |VID30 | ||||
| Function/Process Mutants/Phenotypes Protein-protein Interactions | del Olmo M, et al. (1997) The Uba2 and Ufd1 proteins of Saccharomyces cerevisiae interact with poly(A) polymerase and affect the polyadenylation activity of cell extracts. Mol Gen Genet 255(2):209-18 | |PAP1 |UBA2 | ||||
| DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs | Johnson ES, et al. (1995) A proteolytic pathway that recognizes ubiquitin as a degradation signal. J Biol Chem 270(29):17442-56 | |DOA1 |RPN4 |SEC63 |UFD2 |UFD4 | ||||
Return to SGD |