UFD1/YGR048W Single Page Format

Help

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

SGD Locus Page

Names and Identifiers [TOP] [NEXT] Help
Standard Name Systematic Name Alias Feature Type SGDID
UFD1 YGR048W   ORF, Verified S000003280
Description
Protein that interacts with Cdc48p and Npl4p, involved in recognition of polyubiquitinated proteins and their presentation to the 26S proteasome for degradation; involved in transporting proteins from the ER to the cytosol

GO Annotations [TOP] [NEXT] Help
Molecular Function
Annotation(s)Reference(s)EvidenceAssigned By
protein bindingBays NW and Hampton RY (2002) Cdc48-Ufd1-Npl4: stuck in the middle with Ub. Curr Biol 12(10):R366-71
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
TAS : Traceable Author Statement
Assigned on 2003-02-22
SGD
Biological Process
Annotation(s)Reference(s)EvidenceAssigned By
cell deathHuttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
SGD Papers Entry  
RCA : Reviewed Computational Analysis
Assigned on 2009-08-06
bioPIXIE_MEFIT
modification-dependent protein catabolic processGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0833
Assigned on 2009-03-04
UniProtKB
protein transportYe Y, et al. (2001) The AAA ATPase Cdc48/p97 and its partners transport proteins from the ER into the cytosol. Nature 414(6864):652-6
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IDA : Inferred from Direct Assay
Assigned on 2002-09-06
SGD
proteolysisHuttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
SGD Papers Entry  
RCA : Reviewed Computational Analysis
Assigned on 2009-08-06
bioPIXIE_MEFIT
response to waterHuttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
SGD Papers Entry  
RCA : Reviewed Computational Analysis
Assigned on 2009-08-06
bioPIXIE_MEFIT
ubiquitin-dependent protein catabolic processBays NW and Hampton RY (2002) Cdc48-Ufd1-Npl4: stuck in the middle with Ub. Curr Biol 12(10):R366-71
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
TAS : Traceable Author Statement
Assigned on 2003-02-22
SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR004854
Assigned on 2009-03-04
UniProtKB
Cellular Component
Annotation(s)Reference(s)EvidenceAssigned By
Cdc48p-Npl4p-Ufd1p AAA ATPase complexSchuberth C and Buchberger A (2005) Membrane-bound Ubx2 recruits Cdc48 to ubiquitin ligases and their substrates to ensure efficient ER-associated protein degradation. Nat Cell Biol 7(10):999-1006
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IDA : Inferred from Direct Assay
Assigned on 2008-02-06
SGD
endoplasmic reticulumYe Y, et al. (2001) The AAA ATPase Cdc48/p97 and its partners transport proteins from the ER into the cytosol. Nature 414(6864):652-6
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IDA : Inferred from Direct Assay
Assigned on 2002-09-06
SGD

Pathways [TOP] [NEXT] Help
No pathways available

Summary Paragraph [TOP] [NEXT] Help
No summary paragraph available

Basic References [TOP]   Help
BASIC INFORMATION REFERENCES forUFD1/YGR048W for UFD1
1)Ye Y, et al. (2001) The AAA ATPase Cdc48/p97 and its partners transport proteins from the ER into the cytosol. Nature 414(6864):652-6
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
2)Braun S, et al. (2002) Role of the ubiquitin-selective CDC48(UFD1/NPL4 )chaperone (segregase) in ERAD of OLE1 and other substrates. EMBO J 21(4):615-21
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
3)Bays NW and Hampton RY (2002) Cdc48-Ufd1-Npl4: stuck in the middle with Ub. Curr Biol 12(10):R366-71
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  

Mutant Phenotypes [TOP] [NEXT] Help
Phenotype page for UFD1/YGR048W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT] Help
Interaction page for UFD1/YGR048W

Homologs [TOP] [NEXT] Help
  • Comparison Resources
  • Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT] Help
    Protein Sequence Calculations
    from Predicted Full length Translation
    N-term MFSGFSS
    C-term PEVIEID
    Length(aa) 361
    MW(Da) 39,810
    pI 6.05
    Amino Acid Composition (full length)
    GCG tools: PepPlot, Helical Wheel, PepStruct

    Transcript Translation Calculations
    Codon Bias 0.045  
    Codon Adaptation Index 0.125  
    Frequency of Optimal Codons 0.433  
    Hydropathicity of Protein -0.410  
    Aromaticity Score 0.086  

                              10        20        30        40        50
                               |         |         |         |         |
                      MFSGFSSFGGGNGFVNMPQTFEEFFRCYPIAMMNDRIRKDDANFGGKIFL
                      PPSALSKLSMLNIRYPMLFKLTANETGRVTHGGVLEFIAEEGRVYLPQWM
                      METLGIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRN
                      FSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPV
                      GYVEPDYKALKAQQDKEKKNSFGKGQVLDPSVLGQGSMSTRIDYAGIANS
                      SRNKLSKFVGQGQNISGKAPKAEPKQDIKDMKITFDGEPAKLDLPEGQLF
                      FGFPMVLPKEDEESAAGSKSSEQNFQGQGISLRKSNKRKTKSDHDSSKSK
                      APKSPEVIEID*
    

    Protein Structures from PDB: proteins of known structure with sequence similarity to UFD1/YGR048W, based on Smith-Waterman analysis. [TOP] [NEXT] Help
    PDB protein structure(s) homologous to UFD1Homolog Source (per PDB)Protein Alignment: UFD1 vs. HomologExternal Links
    P-Value%Identical%SimilarAlignment
    1zc1 ( Chain: A)
    Ufd1 exhibits the aaa-atpase fold with two distinct ubiquitin interaction sites
  • PDB_Info
  • PDB_Structure
  • Saccharomyces cerevisiae1.4e-881000View alignmentSCOP
    MMDB
    CATH
    2yuj ( Chain: A)
    Solution structure of human ubiquitin fusion degradation protein 1 homolog ufd1
  • PDB_Info
  • PDB_Structure
  • Homo sapiens3.3e-364832View alignmentSCOP
    MMDB
    CATH

    Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT] Help
  • Functional Analysis
  • You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

    Locus History (misc. notes) [TOP] [NEXT] Help
    Nomenclature History
    Standard NameReference
    UFD1SGD (2007) Information without a citation in SGD
    SGD Papers Entry  
    Mapping Notes
    DateNote
    1997-10-20Edition 14: UFD1 has also been called PIP3, not to be confused with MEC3 which has also been called PIP3

    Cherry JM, et al. (1997) Genetic and physical maps of Saccharomyces cerevisiae. Nature 387(6632 Suppl):67-73
    SGD Papers Entry  Pubmed Entry  Reference full text  

    Sequence Retrieval [TOP] [NEXT] Help
    Sequence Type Output Format
    Genomic DNA GCG | FASTA | NoHeader
    Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader
    DNA coding sequence
    (without introns, without flanking regions)
    GCG | FASTA | NoHeader
    Protein Translation of ORF GCG | FASTA | NoHeader
    6-Frame Translation(with Restriction Map) GCG
    Restriction Fragment Sizes GCG
  • Sequence Analysis Tools
  • Sequence from other databases
    Sequence IDSource
    YGR048WSGD Systematic Sequence
    852939NCBI: Gene ID
    NP_011562.1NCBI: RefSeq protein version ID
    NP_011562.1NCBI: RefSeq protein version ID
    6321485NCBI: NCBI protein GI

    Map and Displays [TOP] [NEXT] Help
    Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
    Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map  

    Localization [TOP] [NEXT] Help
  • Localization Resources
  • Community Annotation [TOP] [NEXT] Help
    No community annotation available.

    Literature Guide: papers categorized by topic. [TOP]   Help
    TopicsReferenceOther Genes Addressed
    59 curated references; 0 references not yet curated
    Function/Process
    Regulatory Role
    Strains/Constructs
    Bhattacharya S, et al. (2009) Identification of lysines within membrane-anchored Mga2p120 that are targets of Rsp5p ubiquitination and mediate mobilization of tethered Mga2p90. J Mol Biol 385(3):718-25
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |MGA2 |NPL4 |OLE1 |RSP5 |SPT23
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Bosis E, et al. (2009) Ssz1 Restores ERAD in Cells Expressing Defective Cdc48-Ufd1-Npl4 Complex by Upregulating Cdc48. Genetics
    SGD Papers Entry  Pubmed Entry  
    |CDC48 |HMG2 |HRD1 |NPL4 |PDR1 |RPN4 |RPT1 |SSZ1
    RNA Levels and Processing
    Metzger MB and Michaelis S (2009) Analysis of quality control substrates in distinct cellular compartments reveals a unique role for Rpn4p in tolerating misfolded membrane proteins. Mol Biol Cell 20(3):1006-19
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ADE17 |ALF1 |CCT3 |CIK1 |DGK1 |ECM29 |GET3 |HAC1 |HRD1 |IDH1 |ITR1 |KAR2 |MAG1 |MIA40 |MORE
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Morgan J, et al. (2009) Altering sphingolipid metabolism in Saccharomyces cerevisiae cells lacking the amphiphysin ortholog Rvs161 reinitiates sugar transporter endocytosis. Eukaryot Cell 8(5):779-89
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |DOA1 |DOA4 |GAL2 |HXT1 |HXT2 |HXT3 |HXT4 |MAL61 |RSP5 |RVS161 |SHP1 |SUC2 |SUR4
    Non-Fungal Related Genes/Proteins
    Spork S, et al. (2009) An unusual ERAD-like complex is targeted to the apicoplast of Plasmodium falciparum. Eukaryot Cell 8(8):1134-45
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |DER1 |HRD1 |HRD3 |NPL4 |RPL40A |RPL40B |RPS31 |UBA1 |UBA2 |UBC4 |UBI4
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Wang Y, et al. (2009) Abnormal proteins can form aggresome in yeast: aggresome-targeting signals and components of the machinery. FASEB J 23(2):451-63
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ADH1 |ATP2 |BMH1 |CDC48 |DSK2 |ENO2 |FBA1 |HSP42 |HSP60 |HSP82 |ILV5 |IPP1 |MDR1 |NOG2 |MORE
    Mutants/Phenotypes
    Strains/Constructs
    Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
    Cellular Location
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Duennwald ML and Lindquist S (2008) Impaired ERAD and ER stress are early and specific events in polyglutamine toxicity. Genes Dev 22(23):3308-3319
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |CUE1 |HAC1 |IRE1 |NPL4 |OLE1 |PMR1 |PRC1 |PRE1 |PRE2 |PRE9 |RAD6 |RPN2 |SEC22 |MORE
    Protein-protein Interactions
    Goder V, et al. (2008) The ER-associated degradation component Der1p and its homolog Dfm1p are contained in complexes with distinct cofactors of the ATPase Cdc48p. FEBS Lett 582(11):1575-80
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |DER1 |DFM1 |HRD1 |HRD3 |KAR2 |NPL4 |SHP1 |UBX2 |UBX7 |USA1 |YOS9
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Kohlmann S, et al. (2008) Ubiquitin Ligase Hul5 Is Required for Fragment-specific Substrate Degradation in Endoplasmic Reticulum-associated Degradation. J Biol Chem 283(24):16374-83
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |HRD1 |HUL5
    Mutants/Phenotypes
    Strains/Constructs
    Medicherla B and Goldberg AL (2008) Heat shock and oxygen radicals stimulate ubiquitin-dependent degradation mainly of newly synthesized proteins. J Cell Biol 182(4):663-73
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |NPL4 |RPN10 |SOD1 |SOD2 |UBC4 |UBC5 |UBC7 |UFD4
    Protein-protein Interactions
    Meednu N, et al. (2008) The Spindle Positioning Protein Kar9p Interacts With the Sumoylation Machinery in Saccharomyces cerevisiae. Genetics 180(4):2033-55
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |BIK1 |BIM1 |CST9 |DYN1 |KAR9 |MYO2 |NFI1 |NIS1 |SIZ1 |SMT3 |STU2 |UBC9 |ULS1 |WSS1
    Function/Process
    Mutants/Phenotypes
    Substrates/Ligands/Cofactors
    Metzger MB, et al. (2008) Degradation of a Cytosolic Protein Requires Endoplasmic Reticulum-associated Degradation Machinery. J Biol Chem 283(47):32302-16
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |CUE1 |HLJ1 |NPL4 |SSA1 |SSM4 |UBC4 |UBC5 |UBC6 |UBC7 |URA3 |YDJ1
    RNA Levels and Processing
    Trott A, et al. (2008) Activation of Heat Shock and Antioxidant Responses by the Natural Product Celastrol: Transcriptional Signatures of a Thiol-targeted Molecule. Mol Biol Cell 19(3):1104-12
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAD14 |AAD15 |AAD16 |AAD3 |AAD4 |AAD6 |ADH5 |ADH6 |AHP1 |ALD3 |ALD4 |ALD6 |ARI1 |ATR1 |MORE
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Braun S and Jentsch S (2007) SM-protein-controlled ER-associated degradation discriminates between different SNAREs. EMBO Rep 8(12):1176-82
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |SED5 |SLY1 |UBC6 |UBC7 |UFE1
    Protein-protein Interactions
    Regulation of
    Strains/Constructs
    Shcherbik N and Haines DS (2007) Cdc48p(Npl4p/Ufd1p) binds and segregates membrane-anchored/tethered complexes via a polyubiquitin signal present on the anchors. Mol Cell 25(3):385-97
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |CDC48 |MGA2 |NPL4 |RSP5 |SPT23
    Other Features
    Regulation of
    Transcription
    Auld KL, et al. (2006) The Conserved ATPase Get3/Arr4 Modulates the Activity of Membrane-Associated Proteins in Saccharomyces cerevisiae. Genetics 174(1):215-27
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  
    |CDC48 |GET1 |GET2 |GET3 |NPL4
    Mutants/Phenotypes
    Heiligenstein S, et al. (2006) Retrotranslocation of a viral A/B toxin from the yeast endoplasmic reticulum is independent of ubiquitination and ERAD. EMBO J 25(20):4717-27
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |DSK2 |HRD1 |JEM1 |KAR2 |NPL4 |PDI1 |PMR1 |RAD23 |RSP5 |SCJ1 |SPF1 |UBC1 |UBC4 |MORE
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Liao M, et al. (2006) Endoplasmic reticulum-associated degradation of cytochrome P450 CYP3A4 in Saccharomyces cerevisiae: further characterization of cellular participants and structural determinants. Mol Pharmacol 69(6):1897-904
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |CUE1 |HRD1 |HRD3 |NPL4 |PEP4 |RPN1 |RSP5 |SSM4 |UBC6 |UBC7
    Protein Processing/Modification/Regulation
    Mirzaei H and Regnier F (2006) Enrichment of carbonylated peptides using Girard P reagent and strong cation exchange chromatography. Anal Chem 78(3):770-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ALA1 |ATP1 |AVL9 |AVO1 |AYT1 |CAF16 |CBS2 |CCT3 |CHO1 |CIN8 |DOA4 |ERV1 |GCN5 |HSH49 |MORE
    Reviews
    Pety de Thozee C and Ghislain M (2006) ER-associated degradation of membrane proteins in yeast. ScientificWorldJournal 6:967-83
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |NPL4 |SAR1
    Mutants/Phenotypes
    Ravid T, et al. (2006) Membrane and soluble substrates of the Doa10 ubiquitin ligase are degraded by distinct pathways. EMBO J 25(3):533-43
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CBF2 |CDC48 |CUE1 |MATALPHA2 |MPS2 |NPL4 |QRI1 |SSM4 |UBC6
    Non-Fungal Related Genes/Proteins
    Reviews
    Romisch K (2006) Cdc48p is UBX-linked to ER ubiquitin ligases. Trends Biochem Sci 31(1):24-5
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |DER1 |HRD1 |NPL4 |UBX2
    Reviews
    Sobko A (2006) Systems biology of AGC kinases in fungi. Sci STKE 2006(352):re9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |HSF1 |HSP82 |HTB1 |PAB1 |PDC2 |PKH1 |PKH2 |SCH9 |SHP1 |SSE1 |SUP35 |YPK1 |YPK2
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Altmann K and Westermann B (2005) Role of essential genes in mitochondrial morphogenesis in Saccharomyces cerevisiae. Mol Biol Cell 16(11):5410-7
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  yfgdb  
    |ARC35 |ARC40 |ARP2 |BFR2 |CCT4 |CCT6 |CDC34 |CDC53 |COF1 |DSL1 |ERG1 |ERG10 |ERG12 |ERG13 |MORE
    Reviews
    Bazirgan OA and Hampton RY (2005) Cdc48-Ufd2-Rad23: the road less ubiquitinated? Nat Cell Biol 7(3):207-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |DSK2 |NPL4 |RAD23 |UFD2
    Reviews
    Lord JM, et al. (2005) Quality control: another player joins the ERAD cast. Curr Biol 15(23):R963-4
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |DER1 |HRD1 |NPL4 |SSM4 |UBX2
    Function/Process
    Protein Sequence Features
    Protein-protein Interactions
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Park S, et al. (2005) Ufd1 exhibits the AAA-ATPase fold with two distinct ubiquitin interaction sites. Structure 13(7):995-1005
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |UBI4
    Function/Process
    Mutants/Phenotypes
    Protein Sequence Features
    Protein-protein Interactions
    Strains/Constructs
    Richly H, et al. (2005) A series of ubiquitin binding factors connects CDC48/p97 to substrate multiubiquitylation and proteasomal targeting. Cell 120(1):73-84
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  
    |CDC48 |DSK2 |NPL4 |RAD23 |RPN10 |SPT23 |UFD2
    Cellular Location
    Mutants/Phenotypes
    Protein-protein Interactions
    Strains/Constructs
    Schuberth C and Buchberger A (2005) Membrane-bound Ubx2 recruits Cdc48 to ubiquitin ligases and their substrates to ensure efficient ER-associated protein degradation. Nat Cell Biol 7(10):999-1006
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |HRD1 |SSM4 |UBX2
    Protein-protein Interactions
    Archambault V, et al. (2004) Targeted proteomic study of the cyclin-Cdk module. Mol Cell 14(6):699-711
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  Web Supplement  
    |ACE2 |ACM1 |BEM3 |BIK1 |BMH2 |BUD3 |CBK1 |CDC25 |CDC28 |CDC4 |CDC48 |CDC53 |CDC6 |CDH1 |MORE
    Reviews
    Cao K and Zheng Y (2004) The Cdc48/p97-Ufd1-Npl4 complex: its potential role in coordinating cellular morphogenesis during the M-G1 transition. Cell Cycle 3(4):422-4
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |NPL4
    Reviews
    Cheeseman IM and Desai A (2004) Cell division: AAAtacking the mitotic spindle. Curr Biol 14(2):R70-2
    SGD Papers Entry  Pubmed Entry  
    |ASE1 |CDC48 |NPL4
    Function/Process
    Strains/Constructs
    Decottignies A, et al. (2004) Binding of Cdc48p to a ubiquitin-related UBX domain from novel yeast proteins involved in intracellular proteolysis and sporulation. Yeast 21(2):127-39
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |DOA1 |UBX4 |UBX6 |UBX7
    Function/Process
    Gnann A, et al. (2004) Cystic fibrosis transmembrane conductance regulator degradation depends on the lectins Htm1p/EDEM and the Cdc48 protein complex in yeast. Mol Biol Cell 15(9):4125-35
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |HRD1 |MNL1 |NPL4 |SSM4
    Protein-protein Interactions
    Mangus DA, et al. (2004) Identification of factors regulating poly(A) tail synthesis and maturation. Mol Cell Biol 24(10):4196-206
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |DIG1 |FIR1 |PAB1 |PAN2 |PAN3 |PBP1 |PBP2 |PBP4 |REF2
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Protein-protein Interactions
    Strains/Constructs
    Medicherla B, et al. (2004) A genomic screen identifies Dsk2p and Rad23p as essential components of ER-associated degradation. EMBO Rep 5(7):692-7
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |DSK2 |NPL4 |RAD23
    Regulation of
    Transcription
    Schade B, et al. (2004) Cold adaptation in budding yeast. Mol Biol Cell 15(12):5492-502
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  Web Supplement  yfgdb  
    |DBP2 |DED1 |GLC3 |GLK1 |GPD1 |GPH1 |GPX1 |GTT2 |HAP5 |HRP1 |HSP10 |HSP104 |HSP12 |HSP26 |MORE
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Schuberth C, et al. (2004) Shp1 and Ubx2 are adaptors of Cdc48 involved in ubiquitin-dependent protein degradation. EMBO Rep 5(8):818-24
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |NPL4 |RPN10 |SHP1 |UBX2 |UBX3 |UBX4 |UBX5 |UBX6 |UBX7
    Non-Fungal Related Genes/Proteins
    Cao K, et al. (2003) The AAA-ATPase Cdc48/p97 regulates spindle disassembly at the end of mitosis. Cell 115(3):355-67
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ASE1 |CDC48 |CDC5 |CLB2 |NPL4
    Fungal Related Genes/Proteins
    Naula N, et al. (2003) Cordycepin in Schizosaccharomyces pombe: effects on the wild type and phenotypes of mutants resistant to the drug. Curr Genet 43(6):400-6
    SGD Papers Entry  Pubmed Entry  

    Reviews
    Schnell JD and Hicke L (2003) Non-traditional functions of ubiquitin and ubiquitin-binding proteins. J Biol Chem 278(38):35857-60
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |CUE1 |MMS2 |NPL4 |RPN10 |RSP5 |STP2 |UBI4
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Taxis C, et al. (2003) Use of modular substrates demonstrates mechanistic diversity and reveals differences in chaperone requirement of ERAD. J Biol Chem 278(38):35903-13
    SGD Papers Entry  Pubmed Entry  
    |CDC48 |CWC23 |DER1 |HLJ1 |HRD1 |HRD3 |HSP104 |JID1 |KAR2 |NPL4 |SSA1 |SSA2 |SSA3 |SSA4 |MORE
    Non-Fungal Related Genes/Proteins
    Reviews
    Woodman PG (2003) p97, a protein coping with multiple identities. J Cell Sci 116(Pt 21):4283-90
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |NPL4 |VPS4
    Function/Process
    Non-Fungal Related Genes/Proteins
    Protein-protein Interactions
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Ye Y, et al. (2003) Function of the p97-Ufd1-Npl4 complex in retrotranslocation from the ER to the cytosol: dual recognition of nonubiquitinated polypeptide segments and polyubiquitin chains. J Cell Biol 162(1):71-84
    SGD Papers Entry  Pubmed Entry  
    |CDC48 |NPL4
    Function/Process
    Protein-protein Interactions
    Reviews
    Substrates/Ligands/Cofactors
    Bays NW and Hampton RY (2002) Cdc48-Ufd1-Npl4: stuck in the middle with Ub. Curr Biol 12(10):R366-71
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |CDC48 |NPL4
    Function/Process
    Protein-protein Interactions
    Substrates/Ligands/Cofactors
    Braun S, et al. (2002) Role of the ubiquitin-selective CDC48(UFD1/NPL4 )chaperone (segregase) in ERAD of OLE1 and other substrates. EMBO J 21(4):615-21
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |NPL4 |OLE1
    Cellular Location
    Function/Process
    Protein-protein Interactions
    Substrates/Ligands/Cofactors
    Bays NW, et al. (2001) HRD4/NPL4 is required for the proteasomal processing of ubiquitinated ER proteins. Mol Biol Cell 12(12):4114-28
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |NPL4
    Function/Process
    Non-Fungal Related Genes/Proteins
    Botta A, et al. (2001) Cloning and characterization of the gene encoding human NPL4, a protein interacting with the ubiquitin fusion-degradation protein (UFD1L). Gene 275(1):39-46
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |NPL4
    Cellular Location
    Function/Process
    Protein-protein Interactions
    Hetzer M, et al. (2001) Distinct AAA-ATPase p97 complexes function in discrete steps of nuclear assembly. Nat Cell Biol 3(12):1086-91
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |NPL4
    Cellular Location
    Function/Process
    Mutants/Phenotypes
    Protein-protein Interactions
    Regulatory Role
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Hitchcock AL, et al. (2001) The conserved npl4 protein complex mediates proteasome-dependent membrane-bound transcription factor activation. Mol Biol Cell 12(10):3226-41
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |MGA2 |NPL4 |OLE1 |SPT23
    Cellular Location
    Function/Process
    Protein-protein Interactions
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Rape M, et al. (2001) Mobilization of processed, membrane-tethered SPT23 transcription factor by CDC48(UFD1/NPL4), a ubiquitin-selective chaperone. Cell 107(5):667-77
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  
    |CDC48 |NPL4 |OLE1 |SPT23
    Disease Gene Related
    Non-Fungal Related Genes/Proteins
    Ratti A, et al. (2001) Cloning and molecular characterization of three ubiquitin fusion degradation 1 (Ufd1) ortholog genes from Xenopus laevis, Gallus gallus and Drosophila melanogaster. Cytogenet Cell Genet 92(3-4):279-82
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Cellular Location
    Function/Process
    Protein-protein Interactions
    Substrates/Ligands/Cofactors
    Ye Y, et al. (2001) The AAA ATPase Cdc48/p97 and its partners transport proteins from the ER into the cytosol. Nature 414(6864):652-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |NPL4
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Hoppe T, et al. (2000) Activation of a membrane-bound transcription factor by regulated ubiquitin/proteasome-dependent processing. Cell 102(5):577-86
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CDC48 |MGA2 |NPL4 |OLE1 |RSP5 |SPT23
    Mutants/Phenotypes
    Strains/Constructs
    Entian KD, et al. (1999) Functional analysis of 150 deletion mutants in Saccharomyces cerevisiae by a systematic approach. Mol Gen Genet 262(4-5):683-702
    SGD Papers Entry  Pubmed Entry  
    |ABM1 |AIM3 |ALT1 |AMN1 |APD1 |APL2 |AVT3 |BIO3 |BIO4 |BIO5 |BNA3 |BUD4 |CFD1 |CHA4 |MORE
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Hammerle M, et al. (1998) Proteins of newly isolated mutants and the amino-terminal proline are essential for ubiquitin-proteasome-catalyzed catabolite degradation of fructose-1,6-bisphosphatase of Saccharomyces cerevisiae. J Biol Chem 273(39):25000-5
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |DOA1 |FBP1 |ICL1 |MDH2 |PCK1 |RMD5 |RPN4 |UBC8 |UFD2 |UFD4 |VID30
    Function/Process
    Mutants/Phenotypes
    Protein-protein Interactions
    del Olmo M, et al. (1997) The Uba2 and Ufd1 proteins of Saccharomyces cerevisiae interact with poly(A) polymerase and affect the polyadenylation activity of cell extracts. Mol Gen Genet 255(2):209-18
    SGD Papers Entry  Pubmed Entry  
    |PAP1 |UBA2
    DNA/RNA Sequence Features
    Function/Process
    Fungal Related Genes/Proteins
    Protein Sequence Features
    Strains/Constructs
    Johnson ES, et al. (1995) A proteolytic pathway that recognizes ubiquitin as a degradation signal. J Biol Chem 270(29):17442-56
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |DOA1 |RPN4 |SEC63 |UFD2 |UFD4


    Return to SGD
    Send a Message to the SGD Curators

    SGDtm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.