BUD9/YGR041W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrVII: 577491 to 579134
CDS: 577491 - 579134

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

BUD9 YGR041W ORF, Verified S000003273

Description
Protein involved in bud-site selection; diploid mutants display a unipolar budding pattern instead of the wild-type bipolar pattern, and bud at the distal pole

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2001-01-19 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
cell cycle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0131
Assigned on 2007-05-23 UniProtKB
cell division Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
cellular bud site selection Zahner JE, et al. (1996) Genetic analysis of the bipolar pattern of bud site selection in the yeast Saccharomyces cerevisiae. Mol Cell Biol 16(4):1857-70
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-26 SGD
reproduction Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
cellular bud neck Harkins HA, et al. (2001) Bud8p and Bud9p, proteins that may mark the sites for bipolar budding in yeast. Mol Biol Cell 12(8):2497-518
       IDA : Inferred from Direct Assay
Assigned on 2002-12-01 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
plasma membrane Krappmann AB, et al. (2007) Distinct domains of yeast cortical tag proteins bud8p and bud9p confer polar localization and functionality. Mol Biol Cell 18(9):3323-39
       IMP : Inferred from Mutant Phenotype
Assigned on 2008-12-09 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-1003
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forBUD9/YGR041W for BUD9
1) Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BUD9/YGR041W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BUD9/YGR041W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MTKITRD

C-term GVGIIRE

Length(aa) 547

MW(Da) 60,750

pI 6.71

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.035

Codon Adaptation Index 0.117

Frequency of Optimal Codons 0.425

Hydropathicity of Protein -0.573

Aromaticity Score 0.079

10 20 30 40 50 | | | | | MTKITRDVSITTENSKSTSGSATASSASLPENDHPIFHQPRARIRSGSLF IEGSDSFPSSEVKSYNVYIDDSKYSEILKGDTNSSSTDGKQVFEDARDDN FHQESHRDLEDSILDLVRRDPEVAAFPLPPPNSNERNRNSSNGSSAETNL NGHSSSGTISTSVLLNMGSAEKHAGTTRGDHMESSSMKSFEKLGTRPSSL FYPPPEGTAPYQGPRATVSGNKSTRQTQGTYSFPSMRYGVDLVSPVEGAV DVAKSRVPNSTLNGTFPDKAFIPHEFQIPKKAWNRIPANKSTSLKTPRNH SLLIDILKPFEAADLANDQRSSSAVLKNTVHSNGQYNPTNETSGTRMQDQ RQKNTNEIDLEKIPNPQVPLGIAMDTMRSPNQLHEKEYESNIEAGLASGV GKGDNSIKQHQYKKIPQEIDRDQQLSFQMETMPIQRIDSSSIRSFDSRIY GFSEIYSIPRVITTLCICLFVPPLFFFFSINGNNGVSNYRLMRMIMNYEH RIGLLKGFEWDIDVQWFRTLCFVLGCIEMLAIFASIGIGFGVGIIRE*

Protein Structures from PDB: proteins of known structure with sequence similarity to BUD9/YGR041W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
BUD9 SGD (2007) Information without a citation in SGD

Standard Name	Reference
BUD9	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YGR041W SGD Systematic Sequence

852932 NCBI: Gene ID

NP_011555.1 NCBI: RefSeq protein version ID

NP_011555.1 NCBI: RefSeq protein version ID

6321478 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YGR041W	SGD Systematic Sequence
852932	NCBI: Gene ID
NP_011555.1	NCBI: RefSeq protein version ID
NP_011555.1	NCBI: RefSeq protein version ID
6321478	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
DNA & RNA Details
Topic Research Highlight Reference Contributor
Other DNA & RNA Details Description: Specifically lower expression in carbon limited chemostat cultures versus carbon excess.
otherTopic: expression
Boer VM, et al. (2003) The genome-wide transcriptional responses of Saccharomyces cerevisiae grown on glucose in aerobic chemostat cultures limited for carbon, nitrogen, phosphorus, or sulfur. J Biol Chem 278(5):3265-74
Viktor Boer
2003-07-25

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
17 curated references; 0 references not yet curated
Reviews
Slaughter BD, et al. (2009) Symmetry breaking in the life cycle of the budding yeast. Cold Spring Harbor Perspect Biol 1(3):a003384
       |AXL1 |AXL2 |BEM1 |BNI1 |BNR1 |BUD2 |BUD3 |BUD4 |BUD5 |BUD8 |CDC24 |CDC42 |FAR1 |RAX1 |MORE
Reviews
Fischer R, et al. (2008) Polarized growth in fungi--interplay between the cytoskeleton, positional markers and membrane domains. Mol Microbiol 68(4):813-26
       |BIK1 |BIM1 |BNI1 |BNR1 |BUD6 |BUD8 |CDC24 |CDC42 |CLA4 |DYN1 |KAR9 |KEL1 |KEL2 |KIP2 |MORE
Cellular Location
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Krappmann AB, et al. (2007) Distinct domains of yeast cortical tag proteins bud8p and bud9p confer polar localization and functionality. Mol Biol Cell 18(9):3323-39
       |BUD5 |BUD8 |RAX1
Reviews
Park HO and Bi E (2007) Central roles of small GTPases in the development of cell polarity in yeast and beyond. Microbiol Mol Biol Rev 71(1):48-96
       |ACT1 |AXL1 |AXL2 |BEM1 |BEM2 |BEM3 |BNI1 |BUD2 |BUD3 |BUD4 |BUD5 |BUD8 |CDC10 |CDC11 |MORE
Cell Cycle Phase Involved
DNA/RNA Sequence Features
RNA Levels and Processing
Transcription
Voth WP, et al. (2007) Forkhead proteins control the outcome of transcription factor binding by antiactivation. EMBO J 26(20):4324-34
         |ACE2 |AIM44 |AMN1 |ASH1 |BAR1 |CDC6 |CLB2 |CTS1 |DSE1 |DSE2 |DSE3 |DSE4 |EGT2 |FAA3 |MORE
RNA Levels and Processing
Guo Y, et al. (2006) Analysis of cellular responses to aflatoxin B(1) in yeast expressing human cytochrome P450 1A2 using cDNA microarrays. Mutat Res 593(1-2):121-42
           |AAT1 |AHA1 |ALD2 |ALD3 |ALK1 |APC1 |APC5 |APT2 |AQR1 |AQY2 |ARC40 |ARN1 |ARO10 |ARO9 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Fujita A, et al. (2004) Rax1, a protein required for the establishment of the bipolar budding pattern in yeast. Gene 327(2):161-9
       |AXL1 |AXL2 |BUD3 |BUD4 |BUD5 |BUD8 |RAX1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Kang PJ, et al. (2004) Interactions among Rax1p, Rax2p, Bud8p, and Bud9p in marking cortical sites for bipolar bud-site selection in yeast. Mol Biol Cell 15(11):5145-57
       |BUD8 |RAX1 |RAX2
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Regulation of
Strains/Constructs
Transcription
Schenkman LR, et al. (2002) The role of cell cycle-regulated expression in the localization of spatial landmark proteins in yeast. J Cell Biol 156(5):829-41
       |ACT1 |BUD8
Cellular Location
Mutants/Phenotypes
Protein Sequence Features
Protein/Nucleic Acid Structure
Strains/Constructs
Harkins HA, et al. (2001) Bud8p and Bud9p, proteins that may mark the sites for bipolar budding in yeast. Mol Biol Cell 12(8):2497-518
       |ACT1 |BNI1 |BUD8
DNA/RNA Sequence Features
Regulation of
Transcription
Iyer VR, et al. (2001) Genomic binding sites of the yeast cell-cycle transcription factors SBF and MBF. Nature 409(6819):533-8
         |ABF1 |APN1 |BBP1 |CAP1 |CDC21 |CDC45 |CDC7 |CLA4 |CLB1 |CLB2 |CLB6 |CLD1 |CLN1 |CLN2 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Kang PJ, et al. (2001) A GDP/GTP exchange factor involved in linking a spatial landmark to cell polarity. Science 292(5520):1376-8
       |AXL2 |BUD3 |BUD5 |BUD8 |RSR1
Cellular Location
Function/Process
Mutants/Phenotypes
Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       |ALG8 |BUD13 |BUD14 |BUD16 |BUD17 |BUD19 |BUD20 |BUD21 |BUD22 |BUD23 |BUD25 |BUD26 |BUD27 |BUD28 |MORE
Cell Cycle Phase Involved
RNA Levels and Processing
Regulation of
Simon I, et al. (2001) Serial regulation of transcriptional regulators in the yeast cell cycle. Cell 106(6):697-708
               |ACE2 |AGA1 |AGA2 |ALK1 |APC1 |ARP7 |ASH1 |BUD4 |BUD8 |CDC20 |CDC21 |CDC45 |CDC6 |CHS1 |MORE
Cell Cycle Phase Involved
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Taheri N, et al. (2000) Asymmetrically localized Bud8p and Bud9p proteins control yeast cell polarity and development. EMBO J 19(24):6686-96
       |BUD8 |RSR1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Yang S, et al. (1997) A role for the actin cytoskeleton of Saccharomyces cerevisiae in bipolar bud-site selection. J Cell Biol 136(1):111-23
       |ABP1 |ACT1 |AXL1 |AXL2 |BUD4 |BUD8 |MAD2 |SAC6 |SLA1 |SLA2 |SPA2 |SRV2
Cell Cycle Phase Involved
Function/Process
Mutants/Phenotypes
Zahner JE, et al. (1996) Genetic analysis of the bipolar pattern of bud site selection in the yeast Saccharomyces cerevisiae. Mol Cell Biol 16(4):1857-70
       |BNI1 |BUD2 |BUD5 |BUD6 |BUD7 |BUD8 |CDC12 |SPA2

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.