---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

CAX4/YGR036C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVII: 558872 to 558153 CDS: 558872 - 558153 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
CAX4	YGR036C	CWH8	ORF, Verified	S000003268
Description
Dolichyl pyrophosphate (Dol-P-P) phosphatase with a luminally oriented active site in the ER, cleaves the anhydride linkage in Dol-P-P, required for Dol-P-P-linked oligosaccharide intermediate synthesis and protein N-glycosylation

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By catalytic activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000326 Assigned on 2008-02-13 UniProtKB dolichyldiphosphatase activity Fernandez F, et al. (2001) The CWH8 gene encodes a dolichyl pyrophosphate phosphatase with a luminally oriented active site in the endoplasmic reticulum of Saccharomyces cerevisiae. J Biol Chem 276(44):41455-64        IDA : Inferred from Direct Assay Assigned on 2007-09-22 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:3.6.1.43 Assigned on 2007-05-23 UniProtKB hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By lipid biosynthetic process Fernandez F, et al. (2001) The CWH8 gene encodes a dolichyl pyrophosphate phosphatase with a luminally oriented active site in the endoplasmic reticulum of Saccharomyces cerevisiae. J Biol Chem 276(44):41455-64        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction Assigned on 2002-09-05 SGD protein amino acid N-linked glycosylation van Berkel MA, et al. (1999) The Saccharomyces cerevisiae CWH8 gene is required for full levels of dolichol-linked oligosaccharides in the endoplasmic reticulum and for efficient N-glycosylation. Glycobiology 9(3):243-53        IMP : Inferred from Mutant Phenotype Assigned on 2002-09-05 SGD translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to endoplasmic reticulum membrane Fernandez F, et al. (2001) The CWH8 gene encodes a dolichyl pyrophosphate phosphatase with a luminally oriented active site in the endoplasmic reticulum of Saccharomyces cerevisiae. J Biol Chem 276(44):41455-64        IDA : Inferred from Direct Assay Assigned on 2002-09-05 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000326 Assigned on 2008-02-13 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for CAX4/YGR036C for CAX4 During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2). Cax4p converts dolichyl pyrophosphate (Dol-P-P) to dolichyl phosphate (Dol-P) in the lumen of the ER (3), possibly to recycle Dol-P-P (4); Dol-P-P is the byproduct of the transfer of a LLO to a protein, and Dol-P is the substrate on the cytosolic side of the ER on which many of the early reactions in N-linked glycosylation occur (see ALG7, DPM1, and ALG5). Cells lacking Cax4p grow slowly, exhibit decreased levels of N-linked glycosylation--although those LLO's that are synthesized are full-length (5)--and accumulate Dol-P-P (3). They have an anomalous cell wall and are sensitive to Calcofluor white (5, 6), hygromycin B (5), and FK506 (7) and resistant to vanadate (5). Overexpression of RER2, SEC59, or LPP1--which generate Dol-P through other pathways--partially suppresses the cax4 phenotype (3). Mutation of CAX4 causes a synthetic lethal interaction with calmodulin (cmd1) and exhibits defective actin organization (7). The mouse CAX4 homolog DOLPP1 complements deletion of CAX4 (8). Last Updated: 2005-07-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forCAX4/YGR036C for CAX4 1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50        2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57      3) Fernandez F, et al. (2001) The CWH8 gene encodes a dolichyl pyrophosphate phosphatase with a luminally oriented active site in the endoplasmic reticulum of Saccharomyces cerevisiae. J Biol Chem 276(44):41455-64        4) Schenk B, et al. (2001) The ins(ide) and out(side) of dolichyl phosphate biosynthesis and recycling in the endoplasmic reticulum. Glycobiology 11(5):61R-70R              5) van Berkel MA, et al. (1999) The Saccharomyces cerevisiae CWH8 gene is required for full levels of dolichol-linked oligosaccharides in the endoplasmic reticulum and for efficient N-glycosylation. Glycobiology 9(3):243-53        6) Ram AF, et al. (1994) A new approach for isolating cell wall mutants in Saccharomyces cerevisiae by screening for hypersensitivity to calcofluor white. Yeast 10(8):1019-30      7) Sekiya-Kawasaki M, et al. (1998) Identification of functional connections between calmodulin and the yeast actin cytoskeleton. Genetics 150(1):43-58        8) Rush JS, et al. (2002) Identification and characterization of a cDNA encoding a dolichyl pyrophosphate phosphatase located in the endoplasmic reticulum of mammalian cells. J Biol Chem 277(47):45226-34

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for CAX4/YGR036C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for CAX4/YGR036C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MNSTAAA C-term NDKSKRD Length(aa) 239 MW(Da) 27,649 pI 8.61 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias -0.014   Codon Adaptation Index 0.110   Frequency of Optimal Codons 0.402   Hydropathicity of Protein 0.260   Aromaticity Score 0.172	10 20 30 40 50 | | | | | MNSTAAAINPNPNVIPFDDTYILYDSHDFLSFLSAYFSLMPILVLAFYLS WFIITRELEACIVAFGQLMNEIFNNVIKNIIKQPRPVSFGASFQNDTIRS GYGMPSAHSQFMGFCFTYNSLKIYTSWKNLNFLEKCIFSGALALLSFCVC FSRVYLHYHNLDQVIVGFSVGALTGSLYFFIVGIIRELGLINWFLKLRIV RLFYMTDSYNLAPLTLKENYEAYWKRINQRSFNDKSKRD*

Protein Structures from PDB: proteins of known structure with sequence similarity to CAX4/YGR036C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
CAX4	Sekiya-Kawasaki M, et al. (1998) Identification of functional connections between calmodulin and the yeast actin cytoskeleton. Genetics 150(1):43-58

Alias Name(s)	Reference
CWH8	van Berkel MA, et al. (1999) The Saccharomyces cerevisiae CWH8 gene is required for full levels of dolichol-linked oligosaccharides in the endoplasmic reticulum and for efficient N-glycosylation. Glycobiology 9(3):243-53

Mapping Notes

Date	Note
1996-09-21	Edition 13: Mapped to chr VII adjacent to ACB1 Cherry JM, et al. (1996) "Genetic and Physical Maps of Saccharomyces cerevisiae (Edition 13)". Pp. 361-364 in 1996 Yeast Genetics and Molecular Biology Meeting Program and Abstracts. Bethesda, MD: The Genetics Society of America

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YGR036C	SGD Systematic Sequence
852924	NCBI: Gene ID
NP_011550.1	NCBI: RefSeq protein version ID
NP_011550.1	NCBI: RefSeq protein version ID
6321473	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
21 curated references; 0 references not yet curated
Function/Process Mutants/Phenotypes Strains/Constructs	Fei W, et al. (2008) Genome-wide analysis of sterol-lipid storage and trafficking in Saccharomyces cerevisiae. Eukaryot Cell 7(2):401-14	|ARV1 |CDC50 |CNB1 |DRS2 |ERG3 |PLC1 |PTC1 |UME6 |VMA21 |VMA9
Cell Cycle Phase Involved Mutants/Phenotypes Strains/Constructs	Fong CS, et al. (2008) Oxidant-induced cell-cycle delay in Saccharomyces cerevisiae: the involvement of the SWI6 transcription factor. FEMS Yeast Res 8(3):386-99	|ADE12 |ADE13 |ADE17 |ADE4 |ADE5,7 |ALD3 |ASF1 |BMH1 |BTN2 |COX15 |CPR6 |CWP1 |EOS1 |FIS1 |MORE
Mutants/Phenotypes Strains/Constructs	Grossmann G, et al. (2008) Plasma membrane microdomains regulate turnover of transport proteins in yeast. J Cell Biol 183(6):1075-88	|CAN1 |COG1 |ELP6 |ERG2 |ERG24 |ERG5 |ERG6 |FUR4 |FYV6 |GOS1 |HNT3 |MDG1 |MNN10 |MNN11 |MORE
Cellular Location Computational analysis	Qi Y, et al. (2008) Finding friends and enemies in an enemies-only network: A graph diffusion kernel for predicting novel genetic interactions and co-complex membership from yeast genetic interactions. Genome Res 18(12):1991-2004	|AAH1 |ADA2 |AGE1 |AGE2 |AIM29 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |ANP1 |ARL3 |ARP3 |ARP4 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Saleem RA, et al. (2008) Genome-wide analysis of signaling networks regulating fatty acid-induced gene expression and organelle biogenesis. J Cell Biol 181(2):281-92	|ARK1 |CDC19 |CLA4 |CLN3 |CTK1 |DBF2 |ELM1 |HRR25 |HSL1 |HXK2 |KIN3 |PEX3 |PHO80 |PHO85 |MORE
Reviews	Ishtar Snoek IS and Yde Steensma H (2007) Factors involved in anaerobic growth of Saccharomyces cerevisiae. Yeast 24(1):1-10	|ADH3 |ARG82 |ARV1 |BTS1 |CDC40 |CNM67 |DBP7 |DRS2 |FZO1 |GPD2 |GUP1 |HFI1 |HPR1 |IES2 |MORE
Mutants/Phenotypes Strains/Constructs	Pagani MA, et al. (2007) Disruption of iron homeostasis in Saccharomyces cerevisiae by high zinc levels: a genome-wide study. Mol Microbiol 65(2):521-37	|ACO1 |ACO2 |ADE1 |ADE12 |ADE13 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADK1 |AFT1 |AKR1 |ARN1 |MORE
Protein Physical Properties	White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36	|ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CHO1 |COS7 |COS8 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Pittet M, et al. (2006) The N-glycosylation defect of cwh8{Delta} yeast cells causes a distinct defect in sphingolipid biosynthesis. Glycobiology 16(2):155-64	|AUR1 |CSG2 |CSH1 |IPT1 |ISC1 |LAC1 |LAG1 |LCB1 |LCB2 |LIP1 |SUR1 |SUR2 |TSC10 |YDC1 |MORE
Fungal Related Genes/Proteins Mutants/Phenotypes	Snoek IS and Steensma HY (2006) Why does Kluyveromyces lactis not grow under anaerobic conditions? Comparison of essential anaerobic genes of Saccharomyces cerevisiae with the Kluyveromyces lactis genome. FEMS Yeast Res 6(3):393-403	|ACP1 |ARB1 |ARG82 |ARH1 |ARV1 |ATM1 |BTS1 |BUR6 |CAB2 |CDC40 |CNM67 |CTF4 |DBP7 |DRS2 |MORE
Mutants/Phenotypes	Wagner MC, et al. (2006) Loss of the homotypic fusion and vacuole protein sorting or golgi-associated retrograde protein vesicle tethering complexes results in gentamicin sensitivity in the yeast Saccharomyces cerevisiae. Antimicrob Agents Chemother 50(2):587-95	|CHC1 |CHS1 |GCS1 |MNN9 |NHX1 |PEP3 |PEP5 |RIB1 |SAC1 |SPS1 |SSZ1 |TLG2 |VPS15 |VPS16 |MORE
Mutants/Phenotypes Strains/Constructs	Askree SH, et al. (2004) A genome-wide screen for Saccharomyces cerevisiae deletion mutants that affect telomere length. Proc Natl Acad Sci U S A 101(23):8658-63	|ADE12 |ADO1 |AGP2 |APE3 |ARG2 |ARV1 |ASC1 |ATG11 |BEM4 |BRE2 |BRO1 |BUD16 |BUD30 |CCW14 |MORE
Mutants/Phenotypes	Lawrence CL, et al. (2004) Evidence of a new role for the high-osmolarity glycerol mitogen-activated protein kinase pathway in yeast: regulating adaptation to citric acid stress. Mol Cell Biol 24(8):3307-23	|ADE4 |AFT1 |AIM18 |AMS1 |ARO2 |BCK1 |BMH1 |BMH2 |BUB1 |CCH1 |CCW14 |CKA1 |CLC1 |CPR3 |MORE
Genetic Interactions Strains/Constructs	Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9	|ARV1 |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |BUD25 |CHO2 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |CNB1 |MORE
Mutants/Phenotypes	Blackburn AS and Avery SV (2003) Genome-wide screening of Saccharomyces cerevisiae to identify genes required for antibiotic insusceptibility of eukaryotes. Antimicrob Agents Chemother 47(2):676-81	|ADH1 |CHC1 |CHS1 |ERG28 |GCS1 |MAC1 |MNN9 |PEP3 |PEP5 |RIB1 |SAC1 |SOD1 |SPS1 |VPS15 |MORE
Function/Process Mutants/Phenotypes	Dimmer KS, et al. (2002) Genetic basis of mitochondrial function and morphology in Saccharomyces cerevisiae. Mol Biol Cell 13(3):847-53	|ABF2 |ACO1 |ADA2 |ADK1 |AEP1 |AEP2 |AEP3 |AFG3 |AFT1 |AIM10 |AIM22 |ALY1 |APQ13 |ARG82 |MORE
Cross-species Expression Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Rush JS, et al. (2002) Identification and characterization of a cDNA encoding a dolichyl pyrophosphate phosphatase located in the endoplasmic reticulum of mammalian cells. J Biol Chem 277(47):45226-34
Alias Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Fernandez F, et al. (2001) The CWH8 gene encodes a dolichyl pyrophosphate phosphatase with a luminally oriented active site in the endoplasmic reticulum of Saccharomyces cerevisiae. J Biol Chem 276(44):41455-64	|DPP1 |LPP1
Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs Techniques and Reagents	van Berkel MA, et al. (1999) The Saccharomyces cerevisiae CWH8 gene is required for full levels of dolichol-linked oligosaccharides in the endoplasmic reticulum and for efficient N-glycosylation. Glycobiology 9(3):243-53
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Sekiya-Kawasaki M, et al. (1998) Identification of functional connections between calmodulin and the yeast actin cytoskeleton. Genetics 150(1):43-58	|ANP1 |CMD1 |MNN10 |MYO2
Alias Mutants/Phenotypes Strains/Constructs	Ram AF, et al. (1994) A new approach for isolating cell wall mutants in Saccharomyces cerevisiae by screening for hypersensitivity to calcofluor white. Yeast 10(8):1019-30	|CWH41 |CWH43 |FKS1 |GAS1 |KRE6 |PTC1 |SPT14 |VMA9 |YCL007C

Return to SGD

Send a Message to the SGD Curators