BUD13/YGL174W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrVII: 174551 to 175351
CDS: 174551 - 175351

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

BUD13 YGL174W CWC26 ORF, Verified S000003142

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2001-02-13. Gene name expires on 2002-02-13.
Description
Subunit of the RES complex, which is required for nuclear pre-mRNA retention and splicing; involved in bud-site selection; diploid mutants display a unipolar budding pattern instead of the wild-type bipolar pattern

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-09-25 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
RNA splicing GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0508
Assigned on 2007-05-23 UniProtKB
cellular bud site selection Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-10 SGD
mRNA export from nucleus Dziembowski A, et al. (2004) Proteomic analysis identifies a new complex required for nuclear pre-mRNA retention and splicing. EMBO J 23(24):4847-56
         IMP : Inferred from Mutant Phenotype
Assigned on 2005-10-06 SGD
mRNA processing GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0507
Assigned on 2007-05-23 UniProtKB
nuclear mRNA splicing, via spliceosome Dziembowski A, et al. (2004) Proteomic analysis identifies a new complex required for nuclear pre-mRNA retention and splicing. EMBO J 23(24):4847-56
         IDA : Inferred from Direct Assay
Assigned on 2005-10-06 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
RES complex Dziembowski A, et al. (2004) Proteomic analysis identifies a new complex required for nuclear pre-mRNA retention and splicing. EMBO J 23(24):4847-56
         IDA : Inferred from Direct Assay
Assigned on 2009-01-27 SGD
cytoplasm GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0963
Assigned on 2008-02-14 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0086
Assigned on 2008-02-13 UniProtKB
nucleus Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       IDA : Inferred from Direct Assay
Assigned on 2002-10-10 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0539
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-0191
Assigned on 2008-02-13 UniProtKB
spliceosomal complex GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0747
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forBUD13/YGL174W for BUD13
1) Ohi MD, et al. (2002) Proteomics analysis reveals stable multiprotein complexes in both fission and budding yeasts containing Myb-related Cdc5p/Cef1p, novel pre-mRNA splicing factors, and snRNAs. Mol Cell Biol 22(7):2011-24

2) Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

3) Dziembowski A, et al. (2004) Proteomic analysis identifies a new complex required for nuclear pre-mRNA retention and splicing. EMBO J 23(24):4847-56

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for BUD13/YGL174W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for BUD13/YGL174W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MALHQYL

C-term YTLQEDY

Length(aa) 266

MW(Da) 30,472

pI 10.13

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.052

Codon Adaptation Index 0.107

Frequency of Optimal Codons 0.392

Hydropathicity of Protein -1.196

Aromaticity Score 0.068

10 20 30 40 50 | | | | | MALHQYLSETYGPTKPKNKTKKKKKESKSDANSDKTSLIVKERLSTLQQE QEKSGVASFSKFDKQKSKNIWKNLETNELSHAITHPSASSITGNESKNDL KEIRAQEPLVTVADKSKTRKTIYRDAQGHKIQEDSKIDDSSFSRSKYEDE KAAEREQYLKNLNMGDVQKLGINVDAHDKKKNQTASSLTIEDPAITFTHD KERTVKTSLLGRKLYDKPAPENRFAIMPGSRWDGVHRSNGFEEKWFAKQN EINEKKVQSYTLQEDY*

Protein Structures from PDB: proteins of known structure with sequence similarity to BUD13/YGL174W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
BUD13 2001-08-13 Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Alias Name(s) Reference
CWC26 Ohi MD, et al. (2002) Proteomics analysis reveals stable multiprotein complexes in both fission and budding yeasts containing Myb-related Cdc5p/Cef1p, novel pre-mRNA splicing factors, and snRNAs. Mol Cell Biol 22(7):2011-24

Standard Name	Date Standardized	Reference
BUD13	2001-08-13	Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70

Alias Name(s)	Reference
CWC26	*Ohi MD, et al.* (2002)** Proteomics analysis reveals stable multiprotein complexes in both fission and budding yeasts containing Myb-related Cdc5p/Cef1p, novel pre-mRNA splicing factors, and snRNAs. Mol Cell Biol 22(7):2011-24

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YGL174W SGD Systematic Sequence

852701 NCBI: Gene ID

NP_011341.1 NCBI: RefSeq protein version ID

NP_011341.1 NCBI: RefSeq protein version ID

6321264 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YGL174W	SGD Systematic Sequence
852701	NCBI: Gene ID
NP_011341.1	NCBI: RefSeq protein version ID
NP_011341.1	NCBI: RefSeq protein version ID
6321264	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
16 curated references; 0 references not yet curated
Protein-protein Interactions
Brooks MA, et al. (2009) Structure of the yeast Pml1 splicing factor and its integration into the RES complex. Nucleic Acids Res 37(1):129-43
       |IST3 |PML1
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Protein-protein Interactions
Protein/Nucleic Acid Structure
Techniques and Reagents
Fabrizio P, et al. (2009) The Evolutionarily Conserved Core Design of the Catalytic Activation Step of the Yeast Spliceosome. Mol Cell 36(4):593-608
       |ACT1 |BRR2 |BUD31 |CBC2 |CDC40 |CEF1 |CLF1 |CUS1 |CWC15 |CWC2 |CWC21 |CWC22 |CWC23 |CWC24 |MORE
Reviews
Wahl MC, et al. (2009) The spliceosome: design principles of a dynamic RNP machine. Cell 136(4):701-18
       |AAR2 |BRR2 |BUD31 |CDC40 |CEF1 |CLF1 |CUS1 |CUS2 |CWC15 |CWC2 |CWC21 |CWC22 |CWC23 |CWC24 |MORE
Function/Process
Protein Physical Properties
Warkocki Z, et al. (2009) Reconstitution of both steps of Saccharomyces cerevisiae splicing with purified spliceosomal components. Nat Struct Mol Biol 16(12):1237-43
     |BFR1 |BRE5 |BRR1 |BRR2 |BUD31 |CBF2 |CDC40 |CEF1 |CIC1 |CKB2 |CLF1 |CSN12 |CTK1 |CTK2 |MORE
Mutants/Phenotypes
Watanabe M, et al. (2009) Comprehensive and quantitative analysis of yeast deletion mutants defective in apical and isotropic bud growth. Curr Genet 55(4):365-80
       |ACT1 |ADA2 |AKR1 |ARC18 |ARP5 |ARP6 |ARP8 |ASF1 |BNR1 |BUD4 |CCR4 |CDC73 |CLB2 |COG1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Hausmann S, et al. (2008) Genetic and Biochemical Analysis of Yeast and Human Cap Trimethylguanosine Synthase: FUNCTIONAL OVERLAP OF 2,2,7-TRIMETHYLGUANOSINE CAPS, SMALL NUCLEAR RIBONUCLEOPROTEIN COMPONENTS, PRE-mRNA SPLICING FACTORS, AND RNA DECAY PATHWAYS. J Biol Chem 283(46):31706-18
       |BRR1 |CWC21 |HTZ1 |IST3 |ISY1 |LEA1 |LSM1 |MRM2 |MUD1 |MUD2 |NAM8 |PAP2 |PAT1 |PRM6 |MORE
Genetic Interactions
Kress TL, et al. (2008) A Single SR-like Protein, Npl3, Promotes Pre-mRNA Splicing in Budding Yeast. Mol Cell 32(5):727-34
     |CUS2 |CWC21 |GBP2 |HRB1 |HTZ1 |IST3 |LEA1 |LSM1 |MLP1 |MUD1 |MUD2 |NAM8 |NPL3 |PAT1 |MORE
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Physical Properties
Protein Sequence Features
Protein-protein Interactions
Protein/Nucleic Acid Structure
Strains/Constructs
Trowitzsch S, et al. (2008) An Unusual RNA Recognition Motif Acts as a Scaffold for Multiple Proteins in the Pre-mRNA Retention and Splicing Complex. J Biol Chem 283(47):32317-32327
       |IST3 |PML1
Cell Cycle Phase Involved
Transcription
Rowicka M, et al. (2007) High-resolution timing of cell cycle-regulated gene expression. Proc Natl Acad Sci U S A 104(43):16892-7
           |BNI4 |CDC11 |CDC12 |CDC28 |CDC3 |CLB1 |CLN2 |CLN3 |FKS1 |GAS1 |GAS5 |GIC2 |HHF2 |HHO1 |MORE
Genetic Interactions
Mutants/Phenotypes
Scherrer FW Jr and Spingola M (2006) A subset of Mer1p-dependent introns requires Bud13p for splicing activation and nuclear retention. RNA 12(7):1361-72
       |AMA1 |HFM1 |MER1 |PML1 |REC107
Protein-protein Interactions
Wang Q, et al. (2005) Interactions of the yeast SF3b splicing factor. Mol Cell Biol 25(24):10745-54
       |BUD31 |CLF1 |CUS1 |HSH155 |HSH49 |IST3 |MUD2 |PML1 |PRP5 |RDS3 |RSE1 |YRA1 |YSF3
Cellular Location
Function/Process
Mutants/Phenotypes
Protein-Nucleic Acid Interactions
Protein-protein Interactions
Strains/Constructs
Dziembowski A, et al. (2004) Proteomic analysis identifies a new complex required for nuclear pre-mRNA retention and splicing. EMBO J 23(24):4847-56
         |CUS1 |HSH155 |HSH49 |IST3 |PML1 |PRP11 |PRP21 |PRP9 |RDS3 |RSE1 |YSF3
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Vincent K, et al. (2003) Genetic interactions with CLF1 identify additional pre-mRNA splicing factors and a link between activators of yeast vesicular transport and splicing. Genetics 164(3):895-907
       |BET4 |BTS1 |CDC40 |CET1 |CLF1 |CWC2 |MUD2 |NTC20 |PRP16 |PRP19 |PRP22 |RDS3 |SSD1 |SYF2
Protein-protein Interactions
Ohi MD, et al. (2002) Proteomics analysis reveals stable multiprotein complexes in both fission and budding yeasts containing Myb-related Cdc5p/Cef1p, novel pre-mRNA splicing factors, and snRNAs. Mol Cell Biol 22(7):2011-24
       |BRR2 |BUD31 |CDC40 |CEF1 |CLF1 |CUS1 |CWC15 |CWC2 |CWC21 |CWC22 |CWC23 |CWC24 |CWC25 |CWC27 |MORE
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Ni L and Snyder M (2001) A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae. Mol Biol Cell 12(7):2147-70
       |ALG8 |BUD14 |BUD16 |BUD17 |BUD19 |BUD20 |BUD21 |BUD22 |BUD23 |BUD25 |BUD26 |BUD27 |BUD28 |BUD30 |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.