---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

TIP20/YGL145W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVII: 230248 to 232353 CDS: 230248 - 232353 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
TIP20	YGL145W	TIP1	ORF, Verified	S000003113
See Nomenclature Note.
Description
Peripheral membrane protein required for fusion of COPI vesicles with the ER; prohibits back-fusion of COPII vesicles with the ER; forms a tethering complex with Sec39p and Dsl1p that interacts with ER SNAREs Sec20p and Use1p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2002-09-30 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB retrograde vesicle-mediated transport, Golgi to ER Frigerio G (1998) The Saccharomyces cerevisiae early secretion mutant tip20 is synthetic lethal with mutants in yeast coatomer and the SNARE proteins Sec22p and Ufe1p. Yeast 14(7):633-46        IGI : Inferred from Genetic Interaction Assigned on 2002-09-30 SGD transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB vesicle-mediated transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0931 Assigned on 2008-02-14 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Dsl1p complex Tripathi A, et al. (2009) Structural characterization of Tip20p and Dsl1p, subunits of the Dsl1p vesicle tethering complex. Nat Struct Mol Biol 16(2):114-23        IDA : Inferred from Direct Assay Assigned on 2009-09-25 SGD endoplasmic reticulum Reilly BA, et al. (2001) Golgi-to-endoplasmic reticulum (ER) retrograde traffic in yeast requires Dsl1p, a component of the ER target site that interacts with a COPI coat subunit. Mol Biol Cell 12(12):3783-96        IDA : Inferred from Direct Assay Assigned on 2002-08-14 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB extrinsic to membrane GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9903 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forTIP20/YGL145W for TIP20 1) Sweet DJ and Pelham HR (1993) The TIP1 gene of Saccharomyces cerevisiae encodes an 80 kDa cytoplasmic protein that interacts with the cytoplasmic domain of Sec20p. EMBO J 12(7):2831-40      2) Kamena F and Spang A (2004) Tip20p prohibits back-fusion of COPII vesicles with the endoplasmic reticulum. Science 304(5668):286-9        3) Tripathi A, et al. (2009) Structural characterization of Tip20p and Dsl1p, subunits of the Dsl1p vesicle tethering complex. Nat Struct Mol Biol 16(2):114-23        4) Lewis MJ, et al. (1997) A novel SNARE complex implicated in vesicle fusion with the endoplasmic reticulum. EMBO J 16(11):3017-24

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for TIP20/YGL145W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for TIP20/YGL145W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MNGIDDL C-term IIYGNIL Length(aa) 701 MW(Da) 81,166 pI 6.28 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.066   Codon Adaptation Index 0.162   Frequency of Optimal Codons 0.459   Hydropathicity of Protein -0.346   Aromaticity Score 0.100

10 20 30 40 50 | | | | | MNGIDDLLNINDRIKQVQNERNELASKLQNLKQSLASNDTEVALSEVIAQ DIIEVGASVEGLEQLRAKYGDLQILNKLEKVAVQQTQMQAGVDKLDSFER QLDELAEQPPDQFTLDDVKALHSKLTSVFATVPQINNIDSQYAAYNKLKS KVTGKYNDVIIQRLATNWSNTFDQKLLEAQWDTQKFASTSVGLVKCLREN STKLYQLSLLYLPLEEETQNGDSERPLSRSNNNQEPVLWNFKSLANNFNV RFTYHFHATSSSSKIETYFQFLNDYLAENLYKCINIFHDDCNGLTKPVIH EQFINYVLQPIRDKVRSTLFQNDLKTLIVLISQILATDKNLLNSFHYHGL GLVSLISDEVWEKWINYEVEMANRQFINITKNPEDFPKSSQNFVKLINKI YDYLEPFYDLDFDLLVRYKLMTCSLIFMNLTSSYLDYILTVDSLNETRTK EQELYQTMAKLQHVNFVYRKIKSLSSNFIFIQLTDIVNSTESKKYNSLFQ NVENDYEKAMSTDMQNSIVHRIQKLLKETLRNYFKISTWSTLEMSVDENI GPSSVPSAELVNSINVLRRLINKLDSMDIPLAISLKVKNELLNVIVNYFT ESILKLNKFNQNGLNQFLHDFKSLSSILSLPSHATNYKCMSLHELVKILK LKYDPNNQQFLNPEYIKTGNFTSLKEAYSIKYLKDTKIQDALYRIIYGNI L*

Protein Structures from PDB: proteins of known structure with sequence similarity to TIP20/YGL145W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to TIP20 Homolog Source (per PDB) Protein Alignment: TIP20 vs. Homolog External Links P-Value %Identical %Similar Alignment 3fhn ( Chain: C, D, A, B) Structure of tip20p PDB_Info PDB_Structure Saccharomyces cerevisiae Chain C = 9.9e-262 100 0 View alignment SCOP MMDB CATH Chain D = 9.9e-262 100 0 View alignment Chain A = 9.9e-262 100 0 View alignment Chain B = 9.9e-262 100 0 View alignment 3etv ( Chain: A) Crystal structure of a tip20p-dsl1p fusion protein PDB_Info PDB_Structure Saccharomyces cerevisiae,undefined, saccharomyces cerevisiae 6.6e-08 100 0 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
TIP20	Lewis MJ, et al. (1997) A novel SNARE complex implicated in vesicle fusion with the endoplasmic reticulum. EMBO J 16(11):3017-24

Alias Name(s)	Reference
TIP1	Sweet DJ and Pelham HR (1993) The TIP1 gene of Saccharomyces cerevisiae encodes an 80 kDa cytoplasmic protein that interacts with the cytoplasmic domain of Sec20p. EMBO J 12(7):2831-40

Nomenclature History Notes

Date	Note
2004-06-08	TIP1 has been used in the literature to refer to both TIP20/YGL145W which encodes a transport protein that interacts with Sec20p, and TIP1/YBR067C which encodes a cold- and heat-shock induced protein of the Srp1p/Tip1p family.

Mapping Notes

Date	Note
1997-10-20	Edition 14: TIP20 has also been referred to as TIP1, but should not be confused with the TIP1/YBR067C gene encoding a cell wall mannoprotein. Cherry JM, et al. (1997) Genetic and physical maps of Saccharomyces cerevisiae. Nature 387(6632 Suppl):67-73

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YGL145W	SGD Systematic Sequence
852732	NCBI: Gene ID
NP_116577.1	NCBI: RefSeq protein version ID
NP_116577.1	NCBI: RefSeq protein version ID
14318435	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
22 curated references; 0 references not yet curated
Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Regulatory Role Strains/Constructs	Ren Y, et al. (2009) A structure-based mechanism for vesicle capture by the multisubunit tethering complex Dsl1. Cell 139(6):1119-29	|DSL1 |EXO70 |SEC17 |SEC20 |SEC22 |SEC39 |UFE1 |USE1
Reviews	Schmitt HD and Jahn R (2009) A tethering complex recruits SNAREs and grabs vesicles. Cell 139(6):1053-5	|BET3 |BET5 |DSL1 |GSG1 |SEC1 |SEC20 |SEC23 |SEC39 |TRS20 |TRS23 |TRS31 |TRS33 |USE1
Cellular Location Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs	Tripathi A, et al. (2009) Structural characterization of Tip20p and Dsl1p, subunits of the Dsl1p vesicle tethering complex. Nat Struct Mol Biol 16(2):114-23	|DSL1 |EXO70 |EXO84 |SEC15 |SEC20 |SEC39 |SEC6 |USE1
Mutants/Phenotypes Strains/Constructs	Zink S, et al. (2009) A link between ER tethering and COP-I vesicle uncoating. Dev Cell 17(3):403-16	|ARF1 |ARF2 |COP1 |DSL1 |EMP47 |GCS1 |GLO3 |RER1 |RET2 |RET3 |SEC12 |SEC13 |SEC27 |SEC28 |MORE
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Cellular Location Computational analysis	Qi Y, et al. (2008) Finding friends and enemies in an enemies-only network: A graph diffusion kernel for predicting novel genetic interactions and co-complex membership from yeast genetic interactions. Genome Res 18(12):1991-2004	|AAH1 |ADA2 |AGE1 |AGE2 |AIM29 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |ANP1 |ARL3 |ARP3 |ARP4 |MORE
Evolution Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Koumandou VL, et al. (2007) Control systems for membrane fusion in the ancestral eukaryote; evolution of tethering complexes and SM proteins. BMC Evol Biol 7():29	|BET3 |BET5 |COG1 |COG2 |COG3 |COG4 |COG5 |COG6 |COG7 |COG8 |DSL1 |EXO70 |EXO84 |GSG1 |MORE
Cellular Location Function/Process Protein-protein Interactions	Kraynack BA, et al. (2005) Dsl1p, Tip20p, and the novel Dsl3(Sec39) protein are required for the stability of the Q/t-SNARE complex at the endoplasmic reticulum in yeast. Mol Biol Cell 16(9):3963-77	|DSL1 |SEC20 |SEC39 |UFE1 |USE1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Li Y, et al. (2005) Structure-based functional analysis reveals a role for the SM protein Sly1p in retrograde transport to the endoplasmic reticulum. Mol Biol Cell 16(9):3951-62	|BOS1 |DSL1 |SEC20 |SEC22 |SLY1 |UFE1 |USE1
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Kamena F and Spang A (2004) Tip20p prohibits back-fusion of COPII vesicles with the endoplasmic reticulum. Science 304(5668):286-9
Cellular Location Protein-protein Interactions Substrates/Ligands/Cofactors	Andag U and Schmitt HD (2003) Dsl1p, an essential component of the Golgi-endoplasmic reticulum retrieval system in yeast, uses the same sequence motif to interact with different subunits of the COPI vesicle coat. J Biol Chem 278(51):51722-34	|DSL1
Fungal Related Genes/Proteins	Weber Y, et al. (2002) Sec20p-interacting proteins (Tip20p, Ufe1p) in the retrograde secretory pathway of the fungal pathogen Candida albicans. Mol Genet Genomics 268(4):468-76	|SEC20 |UFE1
Alias Function/Process Fungal Related Genes/Proteins Regulation of	Abramova N, et al. (2001) Reciprocal regulation of anaerobic and aerobic cell wall mannoprotein gene expression in Saccharomyces cerevisiae. J Bacteriol 183(9):2881-7	|CWP1 |CWP2 |DAN1 |DAN4 |MOT3 |PAU23 |PAU24 |TIP1 |TIR1 |TIR2 |TIR3 |TIR4 |UPC2
Cellular Location Function/Process Genetic Interactions	Andag U, et al. (2001) The coatomer-interacting protein Dsl1p is required for Golgi-to-endoplasmic reticulum retrieval in yeast. J Biol Chem 276(42):39150-60	|COP1 |DSL1 |ERD2 |KAR2 |SEC20 |SEC22
Cellular Location Function/Process Protein Physical Properties Protein-protein Interactions	Reilly BA, et al. (2001) Golgi-to-endoplasmic reticulum (ER) retrograde traffic in yeast requires Dsl1p, a component of the ER target site that interacts with a COPI coat subunit. Mol Biol Cell 12(12):3783-96	|DSL1 |KAR2 |RET2 |SEC20 |SLY1 |UFE1
Fungal Related Genes/Proteins Protein-protein Interactions	Weber Y, et al. (2001) Divergence of eukaryotic secretory components: the Candida albicans homolog of the Saccharomyces cerevisiae ++Sec20 protein is N terminally truncated, and its levels determine antifungal drug resistance and growth. J Bacteriol 183(1):46-54	|SEC20
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Frigerio G (1998) The Saccharomyces cerevisiae early secretion mutant tip20 is synthetic lethal with mutants in yeast coatomer and the SNARE proteins Sec22p and Ufe1p. Yeast 14(7):633-46	|RET2 |SEC20 |SEC21 |SEC22 |SEC27 |UFE1
Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Patel SK, et al. (1998) Organelle membrane fusion: a novel function for the syntaxin homolog Ufe1p in ER membrane fusion. Cell 92(5):611-20	|CDC48 |SEC20 |UFE1
Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Cosson P, et al. (1997) The Sec20/Tip20p complex is involved in ER retrieval of dilysine-tagged proteins. Eur J Cell Biol 73(2):93-7	|EMP47 |SEC20
Cellular Location Function/Process	Lewis MJ, et al. (1997) A novel SNARE complex implicated in vesicle fusion with the endoplasmic reticulum. EMBO J 16(11):3017-24	|SEC20 |SEC22 |UFE1
DNA/RNA Sequence Features Function/Process Protein-protein Interactions	Voet M, et al. (1997) The sequence of a nearly unclonable 22.8 kb segment on the left arm chromosome VII from Saccharomyces cerevisiae reveals ARO2, RPL9A, TIP1, MRF1 genes and six new open reading frames. Yeast 13(2):177-82	|ARO2 |FLC3 |GPI10 |HUL5 |MRF1 |ROG1 |RPL9A |RRT6 |SEC20 |YGL140C
Alias Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs Techniques and Reagents	Sweet DJ and Pelham HR (1993) The TIP1 gene of Saccharomyces cerevisiae encodes an 80 kDa cytoplasmic protein that interacts with the cytoplasmic domain of Sec20p. EMBO J 12(7):2831-40	|SEC20

Return to SGD

Send a Message to the SGD Curators