GPI10/YGL142C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrVII: 238124 to 236274
CDS: 238124 - 236274

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

GPI10 YGL142C ORF, Verified S000003110

Description
Integral membrane protein involved in glycosylphosphatidylinositol (GPI) anchor synthesis; putative alpha 1,2 mannosyltransferase required for addition of the third mannose onto the GPI core structure; human PIG-Bp is a functional homolog

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
dolichyl-phosphate-mannose-glycolipid alpha-mannosyltransferase activity Canivenc-Gansel E, et al. (1998) GPI anchor biosynthesis in yeast: phosphoethanolamine is attached to the alpha1,4-linked mannose of the complete precursor glycophospholipid. Glycobiology 8(8):761-70
       IMP : Inferred from Mutant Phenotype
Assigned on 2009-01-29 SGD
Sutterlin C, et al. (1998) Saccharomyces cerevisiae GPI10, the functional homologue of human PIG-B, is required for glycosylphosphatidylinositol-anchor synthesis. Biochem J 332 ( Pt 1)():153-9
       IMP : Inferred from Mutant Phenotype
Assigned on 2009-01-29 SGD
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
transferase activity, transferring glycosyl groups DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR005599
Assigned on 2009-01-12 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0328
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
GPI anchor biosynthetic process Jentsch S and Ulrich HD (1998) Protein breakdown. Ubiquitous deja vu. Nature 395(6700):321, 323
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-03 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR005599
Assigned on 2008-10-13 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0337
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane Canivenc-Gansel E, et al. (1998) GPI anchor biosynthesis in yeast: phosphoethanolamine is attached to the alpha1,4-linked mannose of the complete precursor glycophospholipid. Glycobiology 8(8):761-70
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2002-09-03 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
intrinsic to endoplasmic reticulum membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR005599
Assigned on 2009-01-12 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forGPI10/YGL142C for GPI10
1) Canivenc-Gansel E, et al. (1998) GPI anchor biosynthesis in yeast: phosphoethanolamine is attached to the alpha1,4-linked mannose of the complete precursor glycophospholipid. Glycobiology 8(8):761-70

2) Sutterlin C, et al. (1998) Saccharomyces cerevisiae GPI10, the functional homologue of human PIG-B, is required for glycosylphosphatidylinositol-anchor synthesis. Biochem J 332 ( Pt 1)():153-9

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for GPI10/YGL142C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for GPI10/YGL142C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MAHEVHR

C-term DIPAADI

Length(aa) 616

MW(Da) 72,565

pI 8.75

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.007

Codon Adaptation Index 0.109

Frequency of Optimal Codons 0.393

Hydropathicity of Protein 0.204

Aromaticity Score 0.182

10 20 30 40 50 | | | | | MAHEVHRIKPKLGRTQIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHW KAFKYGELTWEWKFGVRSYLFPMIFELTYRLVSLSSILLHYALLLLSTIG SDLLILLLPKYELSWQVAEDLKRLPFDVTRSFEYYGVIYAPKIVMAVLAS IGEYYIVRFVQKLYLLTLDKRNEKEEEERRSGLSEITKFALLLSLTNFFN CFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACLQ RPSSGLIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIID MYFYEKVTFPFFRFLKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPA FAFGLFFPLSKRSFPKKYLNPFFQVKLTILLNLLVYSTLPHKEFRFIFPL QPLFILISSFGLLRLDRDYWKRLSGLKSLLWLVPFVSVFIALLLDTFHES GSIEVMKFLHEEPEIDSLGFIMPCHSTPGQSYLHRSDIQDLWSITCNPPL HLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRKDLRSPGKTYS HEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSGDIII YYKLPFDYSDIPAADI*

Protein Structures from PDB: proteins of known structure with sequence similarity to GPI10/YGL142C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
GPI10 SGD (2007) Information without a citation in SGD

Standard Name	Reference
GPI10	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YGL142C SGD Systematic Sequence

852735 NCBI: Gene ID

NP_011373.1 NCBI: RefSeq protein version ID

NP_011373.1 NCBI: RefSeq protein version ID

6321296 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YGL142C	SGD Systematic Sequence
852735	NCBI: Gene ID
NP_011373.1	NCBI: RefSeq protein version ID
NP_011373.1	NCBI: RefSeq protein version ID
6321296	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
20 curated references; 0 references not yet curated
Reviews
Fujita M and Kinoshita T (2009) Structural remodeling of GPI anchors during biosynthesis and after attachment to proteins. FEBS Lett
     |ARV1 |BST1 |CDC1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |MORE
Transcription
Lickwar CR, et al. (2009) The Set2/Rpd3S pathway suppresses cryptic transcription without regard to gene length or transcription frequency. PLoS ONE 4(3):e4886
       |SET2
Mutants/Phenotypes
Strains/Constructs
Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
       |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Reviews
Fujita M and Jigami Y (2008) Lipid remodeling of GPI-anchored proteins and its function. Biochim Biophys Acta 1780(3):410-20
       |BST1 |CDC42 |CWH43 |EGT2 |EMP24 |ERI1 |ERV25 |FUR4 |GAS1 |GUP1 |GWT1 |IRE1 |LAS21 |MCD4 |MORE
Reviews
Bosson R and Conzelmann A (2007) Multiple functions of inositolphosphorylceramides in the formation and intracellular transport of glycosylphosphatidylinositol-anchored proteins in yeast. Biochem Soc Symp (74):199-209
     |BST1 |ERI1 |GAA1 |GAB1 |GPI1 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |GPI19 |MORE
Reviews
Orlean P and Menon AK (2007) Thematic review series: lipid posttranslational modifications. GPI anchoring of protein in yeast and mammalian cells, or: how we learned to stop worrying and love glycophospholipids. J Lipid Res 48(5):993-1011
         |BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Reviews
Pittet M and Conzelmann A (2007) Biosynthesis and function of GPI proteins in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):405-20
       |BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Cross-species Expression
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Wiedman JM, et al. (2007) In vivo characterization of the GPI assembly defect in yeast mcd4-174 mutants and bypass of the Mcd4p-dependent step in mcd4Delta cells. FEMS Yeast Res 7(1):78-83
         |GPI11 |MCD4
Non-Fungal Related Genes/Proteins
Zhu Y, et al. (2006) Ethanolaminephosphate side chain added to glycosylphosphatidylinositol (GPI) anchor by mcd4p is required for ceramide remodeling and forward transport of GPI proteins from endoplasmic reticulum to Golgi. J Biol Chem 281(29):19830-9
       |GAS1 |GPI1 |LAS21 |MCD4 |YPS1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52
           |ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
Non-Fungal Related Genes/Proteins
Delorenzi M, et al. (2002) Genes for glycosylphosphatidylinositol toxin biosynthesis in Plasmodium falciparum. Infect Immun 70(8):4510-22
         |DPM1 |GAA1 |GPI1 |GPI12 |GPI13 |GPI14 |GPI8 |SPT14
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Grimme SJ, et al. (2001) The essential Smp3 protein is required for addition of the side-branching fourth mannose during assembly of yeast glycosylphosphatidylinositols. J Biol Chem 276(29):27731-9
       |ALG12 |ALG9 |GAA1 |GPI1 |GPI11 |GPI13 |SMP3
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Imhof I, et al. (2000) Phosphatidylethanolamine is the donor of the phosphorylethanolamine linked to the alpha1,4-linked mannose of yeast GPI structures. Glycobiology 10(12):1271-5
       |CPT1 |EPT1
Function/Process
Reviews
Kinoshita T and Inoue N (2000) Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis. Curr Opin Chem Biol 4(6):632-8
       |DPM1 |GAA1 |GPI1 |GPI13 |GPI14 |GPI19 |GPI2 |GPI8 |LAS21 |MCD4 |SMP3 |SPT14
Cross-species Expression
Non-Fungal Related Genes/Proteins
Nagamune K, et al. (2000) Critical roles of glycosylphosphatidylinositol for Trypanosoma brucei. Proc Natl Acad Sci U S A 97(19):10336-41

Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Ng DT, et al. (2000) The unfolded protein response regulates multiple aspects of secretory and membrane protein biogenesis and endoplasmic reticulum quality control. J Cell Biol 150(1):77-88
       |GAS1 |HAC1 |IRE1 |KAR2 |LHS1 |MCD4 |PER1 |PRC1 |RFT1 |RPN4 |SEC61 |UBC7
Mutants/Phenotypes
Strains/Constructs
Victoria Escribano M and Mazon MJ (2000) Disruption of six novel ORFs from Saccharomyces cerevisiae chromosome VII and phenotypic analysis of the deletants. Yeast 16(7):621-30
       |ITC1 |MRM2 |PCL10 |ROG1 |YGL138C
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Canivenc-Gansel E, et al. (1998) GPI anchor biosynthesis in yeast: phosphoethanolamine is attached to the alpha1,4-linked mannose of the complete precursor glycophospholipid. Glycobiology 8(8):761-70
       |ALG12 |ALG9 |SMP3
Cross-species Expression
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Sutterlin C, et al. (1998) Saccharomyces cerevisiae GPI10, the functional homologue of human PIG-B, is required for glycosylphosphatidylinositol-anchor synthesis. Biochem J 332 ( Pt 1)():153-9

DNA/RNA Sequence Features
Mapping
Protein Sequence Features
Voet M, et al. (1997) The sequence of a nearly unclonable 22.8 kb segment on the left arm chromosome VII from Saccharomyces cerevisiae reveals ARO2, RPL9A, TIP1, MRF1 genes and six new open reading frames. Yeast 13(2):177-82
       |ARO2 |FLC3 |HUL5 |MRF1 |ROG1 |RPL9A |RRT6 |SEC20 |TIP20 |YGL140C

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.