---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP145/YGL092W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVII: 337909 to 341862 CDS: 337909 - 341862 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP145	YGL092W	RAT10	ORF, Verified	S000003060
Description
Essential nucleoporin, catalyzes its own cleavage in vivo to generate a C-terminal fragment that assembles into the Nup84p subcomplex of the nuclear pore complex, and an N-terminal fragment of unknown function that is homologous to Nup100p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By RNA binding Fabre E, et al. (1994) Nup145p is required for nuclear export of mRNA and binds homopolymeric RNA in vitro via a novel conserved motif. Cell 78(2):275-89        IDA : Inferred from Direct Assay Assigned on 2007-02-02 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0694 Assigned on 2007-05-23 UniProtKB hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2007-05-23 UniProtKB structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD chromosome localization Therizols P, et al. (2006) Telomere tethering at the nuclear periphery is essential for efficient DNA double strand break repair in subtelomeric region. J Cell Biol 172(2):189-99          IMP : Inferred from Mutant Phenotype Assigned on 2006-02-22 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal subunit export from nucleus Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA splicing, via endonucleolytic cleavage and ligation Sharma K, et al. (1996) Yeast nucleoporin mutants are defective in pre-tRNA splicing. Mol Cell Biol 16(1):294-301        IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007230 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Nup107-160 complex Lutzmann M, et al. (2002) Modular self-assembly of a Y-shaped multiprotein complex from seven nucleoporins. EMBO J 21(3):387-97                IDA : Inferred from Direct Assay Assigned on 2009-10-09 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007230 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP145/YGL092W for NUP145 NUP145 encodes an essential nuclear pore protein (1). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 1, 2, 3, 4). The structure of the vertebrate NPC has been studied extensively; recent reviews include 5, 6, 7, and 8. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (9, 10). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 1, 2, 11, 12, 13). The N- and C-terminal domains of Nup145p are functionally distinct (14, 15, 16) and are cleaved in vivo (15, 16), though the cleavage is not essential for Nup145p function (15). The N-terminal half of Nup145p contains multiple repeats of the amino acids GLFG (17, 1) and is similar to Nup100p and Nup116p (18, 1). The C-terminal half assembles into the NPC subcomplex containing Nup84p and several other nucleoporins (16, 19, 1). Mutations in NUP145 cause defects in nuclear protein import and nuclear RNA export (20, 21, 1, 15, 14). nup145 mutations are also synthetically lethal with mutations in several other nucleoporin genes (1). A related nucleoporin, Nup98, has been identified in vertebrates (1). Last Updated: 1999-08-10

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP145/YGL092W for NUP145 1) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      2) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    3) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      4) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      5) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      6) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      7) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      8) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      9) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      10) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        11) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      12) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        13) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      14) Dockendorff TC, et al. (1997) C-terminal truncations of the yeast nucleoporin Nup145p produce a rapid temperature-conditional mRNA export defect and alterations to nuclear structure. Mol Cell Biol 17(2):906-20        15) Emtage JL, et al. (1997) Defining the essential functional regions of the nucleoporin Nup145p. J Cell Sci 110 ( Pt 7):911-25        16) Teixeira MT, et al. (1997) Two functionally distinct domains generated by in vivo cleavage of Nup145p: a novel biogenesis pathway for nucleoporins. EMBO J 16(16):5086-97        17) Wente SR, et al. (1992) A new family of yeast nuclear pore complex proteins. J Cell Biol 119(4):705-23      18) Wente SR and Blobel G (1994) NUP145 encodes a novel yeast glycine-leucine-phenylalanine-glycine (GLFG) nucleoporin required for nuclear envelope structure. J Cell Biol 125(5):955-69      19) Siniossoglou S, et al. (1996) A novel complex of nucleoporins, which includes Sec13p and a Sec13p homolog, is essential for normal nuclear pores. Cell 84(2):265-75        20) Fabre E, et al. (1994) Nup145p is required for nuclear export of mRNA and binds homopolymeric RNA in vitro via a novel conserved motif. Cell 78(2):275-89        21) Sharma K, et al. (1996) Yeast nucleoporin mutants are defective in pre-tRNA splicing. Mol Cell Biol 16(1):294-301        22) Teixeira MT, et al. (1999) Self-catalyzed cleavage of the yeast nucleoporin Nup145p precursor. J Biol Chem 274(45):32439-44

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP145/YGL092W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP145/YGL092W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MFNKSVN C-term MKCTYKI Length(aa) 1,317 MW(Da) 145,660 pI 5.51 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.041   Codon Adaptation Index 0.134   Frequency of Optimal Codons 0.425   Hydropathicity of Protein -0.463   Aromaticity Score 0.087

10 20 30 40 50 | | | | | MFNKSVNSGFTFGNQNTSTPTSTPAQPSSSLQFPQKSTGLFGNVNVNANT STPSPSGGLFNANSNANSISQQPANNSLFGNKPAQPSGGLFGATNNTTSK SAGSLFGNNNATANSTGSTGLFSGSNNIASSTQNGGLFGNSNNNNITSTT QNGGLFGKPTTTPAGAGGLFGNSSSTNSTTGLFGSNNTQSSTGIFGQKPG ASTTGGLFGNNGASFPRSGETTGTMSTNPYGINISNVPMAVADMPRSITS SLSDVNGKSDAEPKPIENRRTYSFSSSVSGNAPLPLASQSSLVSRLSTRL KATQKSTSPNEIFSPSYSKPWLNGAGSAPLVDDFFSSKMTSLAPNENSIF PQNGFNFLSSQRADLTELRKLKIDSNRSAAKKLKLLSGTPAITKKHMQDE QDSSENEPIANADSVTNIDRKENRDNNLDNTYLNGKEQSNNLNKQDGENT LQHEKSSSFGYWCSPSPEQLERLSLKQLAAVSNFVIGRRGYGCITFQHDV DLTAFTKSFREELFGKIVIFRSSKTVEVYPDEATKPMIGHGLNVPAIITL ENVYPVDKKTKKPMKDTTKFAEFQVFDRKLRSMREMNYISYNPFGGTWTF KVNHFSIWGLVNEEDAEIDEDDLSKQEDGGEQPLRKVRTLAQSKPSDKEV ILKTDGTFGTLSGKDDSIVEEKAYEPDLSDADFEGIEASPKLDVSKDWVE QLILAGSSLRSVFATSKEFDGPCQNEIDLLFSECNDEIDNAKLIMKERRF TASYTFAKFSTGSMLLTKDIVGKSGVSIKRLPTELQRKFLFDDVYLDKEI EKVTIEARKSNPYPQISESSLLFKDALDYMEKTSSDYNLWKLSSILFDPV SYPYKTDNDQVKMALLKKERHCRLTSWIVSQIGPEIEEKIRNSSNEIEQI FLYLLLNDVVRASKLAIESKNGHLSVLISYLGSNDPRIRDLAELQLQKWS TGGCSIDKNISKIYKLLSGSPFEGLFSLKELESEFSWLCLLNLTLCYGQI DEYSLESLVQSHLDKFSLPYDDPIGVIFQLYAANENTEKLYKEVRQRTNA LDVQFCWYLIQTLRFNGTRVFSKETSDEATFAFAAQLEFAQLHGHSLFVS CFLNDDKAAEDTIKRLVMREITLLRASTNDHILNRLKIPSQLIFNAQALK DRYEGNYLSEVQNLLLGSSYDLAEMAIVTSLGPRLLLSNNPVQNNELKTL REILNEFPDSERDKWSVSINVFEVYLKLVLDNVETQETIDSLISGMKIFY DQYKHCREVAACCNVMSQEIVSKILEKNNPSIGDSKAKLLELPLGQPEKA YLRGEFAQDLMKCTYKI*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP145/YGL092W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to NUP145 Homolog Source (per PDB) Protein Alignment: NUP145 vs. Homolog External Links P-Value %Identical %Similar Alignment 3bg0 ( Chain: G, F, B, C) Architecture of a coat for the nuclear pore membrane PDB_Info PDB_Structure Homo sapiens | Saccharomyces cerevisiae Chain G = 6.2e-169 100 0 View alignment SCOP MMDB CATH Chain F = 6.2e-169 100 0 View alignment Chain B = 6.2e-169 100 0 View alignment Chain C = 6.2e-169 100 0 View alignment 3bg1 ( Chain: B, G, C, F) Architecture of a coat for the nuclear pore membrane PDB_Info PDB_Structure Homo sapiens | Saccharomyces cerevisiae Chain B = 6.2e-169 100 0 View alignment SCOP MMDB CATH Chain G = 6.2e-169 100 0 View alignment Chain C = 6.2e-169 100 0 View alignment Chain F = 6.2e-169 100 0 View alignment 3iko ( Chain: B, H, E) Nucleoporin NUP145C PDB_Info PDB_Structure Unknown Chain B = 6.2e-169 100 0 View alignment SCOP MMDB CATH Chain H = 6.2e-169 100 0 View alignment Chain E = 6.2e-169 100 0 View alignment 2q5x ( Chain: A) Crystal structure of the c-terminal domain of hnup98 PDB_Info PDB_Structure Homo sapiens 9.9e-12 36 28 View alignment SCOP MMDB CATH 2q5y ( Chain: C, A) Crystal structure of the c-terminal domain of hnup98 PDB_Info PDB_Structure Homo sapiens Chain C = 6.4e-11 36 27 View alignment SCOP MMDB CATH Chain A = 6.4e-11 36 27 View alignment 1ko6 ( Chain: C, A) Crystal structure of c-terminal autoproteolytic domain of nucleoporin nup98 PDB_Info PDB_Structure Homo sapiens Chain C = 6.6e-11 33 29 View alignment SCOP MMDB CATH Chain A = 6.6e-11 33 29 View alignment 2aiv ( Chain: A) Multiple conformations in the ligand-binding site of the yeast nuclear pore targeting domain of nup116p PDB_Info PDB_Structure Saccharomyces cerevisiae 5.7e-10 36 27 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP145	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YGL092W	SGD Systematic Sequence
852788	NCBI: Gene ID
NP_011423.1	NCBI: RefSeq protein version ID
NP_011423.1	NCBI: RefSeq protein version ID
6321346	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
61 curated references; 0 references not yet curated
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NIC96 |NMD5 |NUP1 |NUP100 |NUP116 |NUP133 |NUP159 |NUP188 |MORE
Protein-protein Interactions	Luo Y, et al. (2010) Resolving the Composition of Protein Complexes Using a MALDI LTQ Orbitrap. J Am Soc Mass Spectrom 21(1):34-46	|APL1 |APL3 |APM4 |APS2 |ASM4 |BMH2 |EDE1 |FKS1 |NIC96 |NSP1 |NUP120 |NUP133 |NUP159 |NUP170 |MORE
Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Beliakova-Bethell N, et al. (2009) Ty3 nuclear entry is initiated by viruslike particle docking on GLFG nucleoporins. J Virol 83(22):11914-25	|NSP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP159 |NUP42 |NUP49 |NUP57 |YGR109W-A |YGR109W-B |YIL080W |YIL082W |YIL082W-A
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Dawson TR, et al. (2009) ER membrane-bending proteins are necessary for de novo nuclear pore formation. J Cell Biol 184(5):659-75	|GLE2 |NEM1 |NIC96 |NUP116 |NUP120 |NUP133 |NUP188 |NUP49 |NUP82 |NUP84 |NUP85 |POM152 |POM34 |RTN1 |MORE
Evolution Non-Fungal Related Genes/Proteins	DeGrasse JA, et al. (2009) Evidence for a shared nuclear pore complex architecture that is conserved from the last common eukaryotic ancestor. Mol Cell Proteomics 8(9):2119-30	|MLP1 |MLP2 |NIC96 |NUP120 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |NUP2 |NUP82 |NUP84 |NUP85
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Other Features	Fokkens L and Snel B (2009) Cohesive versus flexible evolution of functional modules in eukaryotes. PLoS Comput Biol 5(1):e1000276	|NUP120 |NUP84 |NUP85 |SEC13 |SEH1
Other Features Protein/Nucleic Acid Structure	Lezon TR, et al. (2009) Global motions of the nuclear pore complex: insights from elastic network models. PLoS Comput Biol 5(9):e1000496	|NUP120 |NUP157 |NUP170 |NUP192 |NUP84 |NUP85 |SEC13 |SEH1
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure	Brohawn SG, et al. (2008) Structural evidence for common ancestry of the nuclear pore complex and vesicle coats. Science 322(5906):1369-73	|NIC96 |NUP133 |NUP84 |SEC13 |SEC31 |SEH1
Protein-protein Interactions Protein/Nucleic Acid Structure	Debler EW, et al. (2008) A fence-like coat for the nuclear pore membrane. Mol Cell 32(6):815-26	|NUP85 |SEC13 |SEH1
Protein-protein Interactions	Tarassov K, et al. (2008) An in vivo map of the yeast protein interactome. Science 320(5882):1465-70	|ACT1 |ARC40 |ARP2 |ATG27 |BEM1 |CDC11 |CHC1 |DHH1 |FMP42 |GYL1 |KEL1 |KEL2 |LAS17 |LSM4 |MORE
Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Yao W, et al. (2008) A versatile interaction platform on the Mex67-Mtr2 receptor creates an overlap between mRNA and ribosome export. EMBO J 27(1):6-16	|MEX67 |MTR2 |NMD3 |NUP116 |NUP120 |NUP159 |NUP82 |NUP84 |NUP85 |SEC13 |SEH1
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP157 |NUP159 |NUP170 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP157 |NUP159 |NUP170 |MORE
Reviews	Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73	|ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |MORE
Non-Fungal Related Genes/Proteins Protein Physical Properties Protein-protein Interactions	Ratner GA, et al. (2007) Molecular Determinants of Binding between Gly-Leu-Phe-Gly Nucleoporins and the Nuclear Pore Complex. J Biol Chem 282(47):33968-76	|NUP100 |NUP116
Regulatory Role	Sarma NJ, et al. (2007) Glucose-responsive regulators of gene expression in Saccharomyces cerevisiae function at the nuclear periphery via a reverse recruitment mechanism. Genetics 175(3):1127-35	|GAL83 |HXK2 |MIG1 |NUP120 |NUP133 |NUP84 |SEC13 |SNF1 |SNF4 |SUC2
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Terry LJ and Wente SR (2007) Nuclear mRNA export requires specific FG nucleoporins for translocation through the nuclear pore complex. J Cell Biol 178(7):1121-32	|KAP104 |MEX67 |NSP1 |NUP1 |NUP100 |NUP116 |NUP2 |NUP49 |NUP57 |NUP60 |PSE1
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP192 |MORE
Genetic Interactions Protein Physical Properties Protein Sequence Features Protein-protein Interactions	Frey S, et al. (2006) FG-rich repeats of nuclear pore proteins form a three-dimensional meshwork with hydrogel-like properties. Science 314(5800):815-7	|NSP1 |NUP116 |NUP49 |NUP57
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Therizols P, et al. (2006) Telomere tethering at the nuclear periphery is essential for efficient DNA double strand break repair in subtelomeric region. J Cell Biol 172(2):189-99	|ESC1 |NUP120 |NUP133 |NUP170 |NUP53 |NUP84 |SIR4 |TEL11L |YKU70
Protein Physical Properties Protein-protein Interactions	Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51	|GLE2 |KAP123 |MEX67 |MLP1 |NIC96 |NSP1 |NUP116 |NUP120 |NUP133 |NUP157 |NUP159 |NUP170 |NUP49 |NUP57 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Menon BB, et al. (2005) Reverse recruitment: the Nup84 nuclear pore subcomplex mediates Rap1/Gcr1/Gcr2 transcriptional activation. Proc Natl Acad Sci U S A 102(16):5749-54	|GCN4 |GCR1 |GCR2 |KAP123 |NOP1 |NUP120 |NUP133 |NUP53 |NUP84 |NUP85 |POM152 |POM34 |RAP1 |SEC13 |MORE
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features	Robinson MA, et al. (2005) Multiple conformations in the ligand-binding site of the yeast nuclear pore-targeting domain of Nup116p. J Biol Chem 280(42):35723-32	|NUP100 |NUP116
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP157 |NUP159 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Feuerbach F, et al. (2002) Nuclear architecture and spatial positioning help establish transcriptional states of telomeres in yeast. Nat Cell Biol 4(3):214-21	|MLP1 |MLP2 |NUP60
Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs	Lutzmann M, et al. (2002) Modular self-assembly of a Y-shaped multiprotein complex from seven nucleoporins. EMBO J 21(3):387-97	|NUP120 |NUP133 |NUP84 |NUP85 |SEC13 |SEH1
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Reviews	Eggleston A (2000) Hush, hush: the origin of telomeric silence. Nat Cell Biol 2(2):E27	|MLP1 |MLP2 |YKU70
Function/Process	Galy V, et al. (2000) Nuclear pore complexes in the organization of silent telomeric chromatin. Nature 403(6765):108-12	|MLP1 |MLP2 |YKU70
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Cellular Location Function/Process Protein-protein Interactions	Siniossoglou S, et al. (2000) Structure and assembly of the Nup84p complex. J Cell Biol 149(1):41-54	|NUP120 |NUP49 |NUP84 |NUP85 |SEC13 |SEH1
Reviews	Tham WH and Zakian VA (2000) Telomeric tethers. Nature 403(6765):34-5	|MLP1 |MLP2 |YKU70
Non-Fungal Related Genes/Proteins	Fontoura BM, et al. (1999) A conserved biogenesis pathway for nucleoporins: proteolytic processing of a 186-kilodalton precursor generates Nup98 and the novel nucleoporin, Nup96. J Cell Biol 144(6):1097-112	|SEC13
Non-Fungal Related Genes/Proteins	Rosenblum JS and Blobel G (1999) Autoproteolysis in nucleoporin biogenesis. Proc Natl Acad Sci U S A 96(20):11370-5	|NUP116
Other Features	Seedorf M, et al. (1999) Interactions between a nuclear transporter and a subset of nuclear pore complex proteins depend on Ran GTPase. Mol Cell Biol 19(2):1547-57	|CRM1 |GLE2 |GSP1 |KAP95 |NSP1 |NUP1 |NUP116 |NUP159 |NUP82 |POM152 |PSE1 |RNA1 |SRM1 |SRP1 |MORE
Reviews	Strasser K and Hurt E (1999) Nuclear RNA export in yeast. FEBS Lett 452(1-2):77-81	|GLE1 |MEX67 |MTR10 |MTR2 |NPL3 |NSP1 |NUP120 |NUP159 |NUP82 |NUP85
Protein Physical Properties Protein Sequence Features	Teixeira MT, et al. (1999) Self-catalyzed cleavage of the yeast nucleoporin Nup145p precursor. J Biol Chem 274(45):32439-44
Cellular Location Function/Process Techniques and Reagents	Bucci M and Wente SR (1998) A novel fluorescence-based genetic strategy identifies mutants of Saccharomyces cerevisiae defective for nuclear pore complex assembly. Mol Biol Cell 9(9):2439-61	|GLE2 |NIC96 |NSP1 |NUP116 |NUP120 |NUP159 |NUP49 |NUP57 |NUP82 |POM152
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |MORE
Function/Process Mutants/Phenotypes Regulatory Role Strains/Constructs	Dockendorff TC, et al. (1997) C-terminal truncations of the yeast nucleoporin Nup145p produce a rapid temperature-conditional mRNA export defect and alterations to nuclear structure. Mol Cell Biol 17(2):906-20
Mutants/Phenotypes Protein Processing/Modification/Regulation Strains/Constructs	Emtage JL, et al. (1997) Defining the essential functional regions of the nucleoporin Nup145p. J Cell Sci 110 ( Pt 7):911-25
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Disease Gene Related Protein-protein Interactions	Neville M, et al. (1997) The importin-beta family member Crm1p bridges the interaction between Rev and the nuclear pore complex during nuclear export. Curr Biol 7(10):767-75	|CRM1 |CUP1-1 |CUP1-2 |KAP104 |MTR10 |NUP42 |NUP49 |NUP57
Function/Process	Saavedra CA, et al. (1997) Yeast heat shock mRNAs are exported through a distinct pathway defined by Rip1p. Genes Dev 11(21):2845-56	|GLE1 |GSP1 |NPL3 |NUP120 |NUP159 |NUP2 |NUP42 |SSA1 |SSA4
Function/Process Genetic Interactions Non-Fungal Related Genes/Proteins Other Features Protein Processing/Modification/Regulation Protein Sequence Features Protein-protein Interactions	Teixeira MT, et al. (1997) Two functionally distinct domains generated by in vivo cleavage of Nup145p: a novel biogenesis pathway for nucleoporins. EMBO J 16(16):5086-97	|NUP100 |NUP116 |NUP120 |NUP84 |NUP85 |SEC13 |SEH1
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP42 |NUP49 |MORE
Other Features	Murphy R, et al. (1996) GLE2, a Saccharomyces cerevisiae homologue of the Schizosaccharomyces pombe export factor RAE1, is required for nuclear pore complex structure and function. Mol Biol Cell 7(12):1921-37	|GLE2 |NUP100 |NUP42 |SRP1
Function/Process Mutants/Phenotypes Strains/Constructs	Sharma K, et al. (1996) Yeast nucleoporin mutants are defective in pre-tRNA splicing. Mol Cell Biol 16(1):294-301	|NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP49 |NUP85
Protein-protein Interactions	Stutz F, et al. (1996) A role for nucleoporin FG repeat domains in export of human immunodeficiency virus type 1 Rev protein and RNA from the nucleus. Mol Cell Biol 16(12):7144-50	|NUP100 |NUP116 |NUP159 |NUP42 |NUP49 |NUP57
Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Iovine MK, et al. (1995) The GLFG repetitive region of the nucleoporin Nup116p interacts with Kap95p, an essential yeast nuclear import factor. J Cell Biol 131(6 Pt 2):1699-713	|KAP95 |NUP100 |NUP116 |NUP49 |NUP57
Fungal Related Genes/Proteins	Pemberton LF, et al. (1995) Disruption of the nucleoporin gene NUP133 results in clustering of nuclear pore complexes. Proc Natl Acad Sci U S A 92(4):1187-91	|NUP133
Non-Fungal Related Genes/Proteins	Powers MA, et al. (1995) Reconstituted nuclei depleted of a vertebrate GLFG nuclear pore protein, p97, import but are defective in nuclear growth and replication. J Cell Biol 128(5):721-36	|NUP116
Protein-protein Interactions	Rexach M and Blobel G (1995) Protein import into nuclei: association and dissociation reactions involving transport substrate, transport factors, and nucleoporins. Cell 83(5):683-92	|GSP1 |KAP95 |NUP1 |NUP2 |NUP57 |SRP1
Function/Process	Schneiter R, et al. (1995) mRNA transport in yeast: time to reinvestigate the functions of the nucleolus. Mol Biol Cell 6(4):357-70	|MTR2 |NPL3 |NUP116 |NUP49 |RNA14
Cellular Location DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Protein-Nucleic Acid Interactions Strains/Constructs	Fabre E, et al. (1994) Nup145p is required for nuclear export of mRNA and binds homopolymeric RNA in vitro via a novel conserved motif. Cell 78(2):275-89	|NSP1 |NUP100 |NUP116
Cellular Location DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Wente SR and Blobel G (1994) NUP145 encodes a novel yeast glycine-leucine-phenylalanine-glycine (GLFG) nucleoporin required for nuclear envelope structure. J Cell Biol 125(5):955-69	|NUP100 |NUP116 |NUP63

Return to SGD

Send a Message to the SGD Curators