---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ALG2/YGL065C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVII: 381274 to 379763 CDS: 381274 - 379763 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ALG2	YGL065C		ORF, Verified	S000003033
Description
Mannosyltransferase that catalyzes two consecutive steps in the N-linked glycosylation pathway; alg2 mutants exhibit temperature-sensitive growth and abnormal accumulation of the lipid-linked oligosaccharide Man2GlcNAc2-PP-Dol

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By glycolipid 3-alpha-mannosyltransferase activity O'Reilly MK, et al. (2006) In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis. Biochemistry 45(31):9593-603        IDA : Inferred from Direct Assay Assigned on 2007-04-17 SGD glycolipid 6-alpha-mannosyltransferase activity O'Reilly MK, et al. (2006) In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis. Biochemistry 45(31):9593-603        IDA : Inferred from Direct Assay Assigned on 2007-04-19 SGD transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0328 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001296 Assigned on 2007-05-23 UniProtKB oligosaccharide-lipid intermediate assembly O'Reilly MK, et al. (2006) In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis. Biochemistry 45(31):9593-603        IDA : Inferred from Direct Assay Assigned on 2007-04-17 SGD translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Cipollo JF, et al. (2001) The yeast ALG11 gene specifies addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol N-glycosylation intermediate formed on the cytosolic side of the endoplasmic reticulum. J Biol Chem 276(24):21828-40        TAS : Traceable Author Statement Assigned on 2002-11-15 SGD O'Reilly MK, et al. (2006) In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis. Biochemistry 45(31):9593-603        IC : Inferred By Curator from oligosaccharide-lipid intermediate assembly Assigned on 2007-04-17 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
lipid-linked oligosaccharide biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ALG2/YGL065C for ALG2 During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2). Alg2p is a mannosyltransferase that catalyzes the addition of both the second and third mannose moieties to the growing oligosaccharide chain during lipid-linked oligosaccharide (LLO) biosynthesis. The second mannose is added via an alpha-1,3 linkage, while the third mannose is added via an alpha-1,6 linkage (3). Yeast alg2 mutants exhibit temperature-sensitive growth and accumulate oligosaccharide chains with one or two mannose residues (4). Alg2p and Alg11p each form independent complexes with Alg1p, but not with each other, on the cytosolic side of the endoplasmic reticulum (5). The human homolog, hALG2 (OMIM), is an alpha 1,3 mannosyltransferase that adds the second mannose to the chain (Alg1p adds the first mannose) and is capable of complementing the yeast alg2-1 mutation (6). Human ALG2 is mutated in the congenital disorder of glycosylation CDG-Ii (OMIM). Note: there is an unrelated human gene also known as ALG2, for apoptosis-linked gene 2 (OMIM). The Rhizomucor pusillus ALG2 homolog also complements alg2-1 and has been identified as either an alpha 1,3 or alpha 1,6 mannosyltransferase (7). Last Updated: 2007-04-17

Basic References [TOP]

BASIC INFORMATION REFERENCES forALG2/YGL065C for ALG2 1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50        2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57      3) O'Reilly MK, et al. (2006) In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis. Biochemistry 45(31):9593-603        4) Huffaker TC and Robbins PW (1983) Yeast mutants deficient in protein glycosylation. Proc Natl Acad Sci U S A 80(24):7466-70      5) Gao XD, et al. (2004) Physical interactions between the Alg1, Alg2, and Alg11 mannosyltransferases of the endoplasmic reticulum. Glycobiology 14(6):559-70              6) Thiel C, et al. (2003) A new type of congenital disorders of glycosylation (CDG-Ii) provides new insights into the early steps of dolichol-linked oligosaccharide biosynthesis. J Biol Chem 278(25):22498-505        7) Takeuchi K, et al. (1999) Characterization of an alg2 mutant of the zygomycete fungus Rhizomucor pusillus. Glycobiology 9(12):1287-93        8) Jackson BJ, et al. (1993) Biosynthesis of asparagine-linked oligosaccharides in Saccharomyces cerevisiae: the alg2 mutation. Glycobiology 3(4):357-64

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ALG2/YGL065C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ALG2/YGL065C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MIEKDKR C-term SYPYEEI Length(aa) 503 MW(Da) 58,047 pI 6.22 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.087   Codon Adaptation Index 0.170   Frequency of Optimal Codons 0.471   Hydropathicity of Protein -0.005   Aromaticity Score 0.137

10 20 30 40 50 | | | | | MIEKDKRTIAFIHPDLGIGGAERLVVDAALGLQQQGHSVIIYTSHCDKSH CFEEVKNGQLKVEVYGDFLPTNFLGRFFIVFATIRQLYLVIQLILQKKVN AYQLIIIDQLSTCIPLLHIFSSATLMFYCHFPDQLLAQRAGLLKKIYRLP FDLIEQFSVSAADTVVVNSNFTKNTFHQTFKYLSNDPDVIYPCVDLSTIE IEDIDKKFFKTVFNEGDRFYLSINRFEKKKDVALAIKAFALSEDQINDNV KLVICGGYDERVAENVEYLKELQSLADEYELSHTTIYYQEIKRVSDLESF KTNNSKIIFLTSISSSLKELLLERTEMLLYTPAYEHFGIVPLEAMKLGKP VLAVNNGGPLETIKSYVAGENESSATGWLKPAVPIQWATAIDESRKILQN GSVNFERNGPLRVKKYFSREAMTQSFEENVEKVIWKEKKYYPWEIFGISF SNFILHMAFIKILPNNPWPFLFMATFMVLYFKNYLWGIYWAFVFALSYPY EEI*

Protein Structures from PDB: proteins of known structure with sequence similarity to ALG2/YGL065C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to ALG2 Homolog Source (per PDB) Protein Alignment: ALG2 vs. Homolog External Links P-Value %Identical %Similar Alignment 2f9f ( Chain: A) Crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. PDB_Info PDB_Structure Archaeoglobus fulgidus DSM 4304 3.3e-05 31 20 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ALG2	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YGL065C	SGD Systematic Sequence
852815	NCBI: Gene ID
NP_011450.1	NCBI: RefSeq protein version ID
NP_011450.1	NCBI: RefSeq protein version ID
6321373	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]

DNA & RNA Details Topic Research Highlight Reference Contributor Other DNA & RNA Details Description: Specifically lower expression in carbon limited chemostat cultures versus carbon excess. otherTopic: expression Boer VM, et al. (2003) The genome-wide transcriptional responses of Saccharomyces cerevisiae grown on glucose in aerobic chemostat cultures limited for carbon, nitrogen, phosphorus, or sulfur. J Biol Chem 278(5):3265-74            Viktor Boer 2003-07-25

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
28 curated references; 0 references not yet curated
Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Kampf M, et al. (2009) Biochemical Characterization and Membrane Topology of Alg2 from Saccharomyces cerevisiae as a Bifunctional {alpha}1,3- and 1,6-Mannosyltransferase Involved in Lipid-linked Oligosaccharide Biosynthesis. J Biol Chem 284(18):11900-12
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG7 |ALR1 |AOS1 |MORE
Fungal Related Genes/Proteins	Deshpande N, et al. (2008) Protein glycosylation pathways in filamentous fungi. Glycobiology 18(8):626-37	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG3 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |DPM1 |MORE
Reviews	Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Bobula J, et al. (2006) Why molecular chaperones buffer mutational damage: a case study with a yeast Hsp40/70 system. Genetics 174(2):937-44	|ARC18 |CDC1 |GPI2 |NOP4 |RPB2 |RRP1 |RRP15 |SAC1 |SCH9 |SPE3 |TAF10 |TRK1 |VPS27 |ZUO1
Reviews	Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |OST1 |MORE
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	O'Reilly MK, et al. (2006) In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis. Biochemistry 45(31):9593-603	|ALG1 |ALG11
Reviews	Weerapana E and Imperiali B (2006) Asparagine-linked protein glycosylation: from eukaryotic to prokaryotic systems. Glycobiology 16(6):91R-101R	|ALG1 |ALG11 |ALG13 |ALG14 |ALG7 |ALG9 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |RFT1 |SEC11 |MORE
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Samuelson J, et al. (2005) The diversity of dolichol-linked precursors to Asn-linked glycans likely results from secondary loss of sets of glycosyltransferases. Proc Natl Acad Sci U S A 102(5):1548-53	|ALG1 |ALG11 |ALG5 |ALG7 |DPM1 |STT3
Cellular Location Protein-protein Interactions Strains/Constructs	Gao XD, et al. (2004) Physical interactions between the Alg1, Alg2, and Alg11 mannosyltransferases of the endoplasmic reticulum. Glycobiology 14(6):559-70	|ALG1 |ALG11
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Janik A, et al. (2003) Overexpression of GDP-mannose pyrophosphorylase in Saccharomyces cerevisiae corrects defects in dolichol-linked saccharide formation and protein glycosylation. Biochim Biophys Acta 1621(1):22-30	|ALG1 |DPM1 |PSA1
Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Thiel C, et al. (2003) A new type of congenital disorders of glycosylation (CDG-Ii) provides new insights into the early steps of dolichol-linked oligosaccharide biosynthesis. J Biol Chem 278(25):22498-505
Function/Process Protein Sequence Features Substrates/Ligands/Cofactors	Cipollo JF, et al. (2001) The yeast ALG11 gene specifies addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol N-glycosylation intermediate formed on the cytosolic side of the endoplasmic reticulum. J Biol Chem 276(24):21828-40	|ALG11 |ALG3 |OCH1
Reviews	Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57	|ALG7
Reviews	Kukuruzinska MA and Lennon-Hopkins K (1999) ALG gene expression and cell cycle progression. Biochim Biophys Acta 1426(2):359-72	|ALG3 |ALG7
Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins	Takeuchi K, et al. (1999) Characterization of an alg2 mutant of the zygomycete fungus Rhizomucor pusillus. Glycobiology 9(12):1287-93
Fungal Related Genes/Proteins	Yamazaki H, et al. (1998) Characterization of alg2 encoding a mannosyltransferase in the zygomycete fungus Rhizomucor pusillus. Gene 221(2):179-84
DNA/RNA Sequence Features Mapping	Rieger M, et al. (1997) Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII. Yeast 13(11):1077-90	|FUS3 |KSS1 |MSB2 |RPL28 |SER2 |SKI8 |YGL069C |YGR012W
Function/Process Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure	Shpakov AO and Derkach KV (1996) [Yeast dolichol-conjugated mannosyltransferases. A theoretical analysis of the primary structure and identification of the sites homologous to other enzymes of the dolichol cycle] Zh Evol Biokhim Fiziol 32(1):3-18	|ALG1
Mutants/Phenotypes	Dean N (1995) Yeast glycosylation mutants are sensitive to aminoglycosides. Proc Natl Acad Sci U S A 92(5):1287-91	|ALG1 |ALG3 |ALG5 |ANP1 |CWH41 |MNN1 |MNN10 |MNN2 |MNN9 |SEC53 |VRG4 |WBP1
Cell Cycle Phase Involved Function/Process RNA Levels and Processing	Lennon K, et al. (1995) Proliferation-dependent differential regulation of the dolichol pathway genes in Saccharomyces cerevisiae. Glycobiology 5(6):633-42	|ALG1 |ALG7
Cell Cycle Phase Involved Function/Process RNA Levels and Processing	Kukuruzinska MA and Lennon K (1994) Growth-related coordinate regulation of the early N-glycosylation genes in yeast. Glycobiology 4(4):437-43	|ALG1 |ALG7
Reviews	Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50	|ALG1 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ANP1 |CWH41 |DPM1 |GDA1 |GFA1 |KRE2 |MNN1 |MNN10 |MORE
DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features RNA Levels and Processing	Jackson BJ, et al. (1993) Biosynthesis of asparagine-linked oligosaccharides in Saccharomyces cerevisiae: the alg2 mutation. Glycobiology 3(4):357-64
Reviews	Conzelmann A, et al. (1991) Biosynthesis of glycophosphoinositol anchors in Saccharomyces cerevisiae. Cell Biol Int Rep 15(9):863-73	|ALG3 |DPM1 |GAS1 |KRE1 |MNN9 |SEC53
Mutants/Phenotypes	Appukuttan PS and Wu HC (1989) Fatty acylation of yeast glycoproteins proceeds independently of N-linked glycosylation. FEBS Lett 255(1):139-42	|ALG1
Function/Process Mutants/Phenotypes	Jackson BJ, et al. (1989) Synthesis of lipid-linked oligosaccharides in Saccharomyces cerevisiae: Man2GlcNAc2 and Man1GlcNAc2 are transferred from dolichol to protein in vivo. Arch Biochem Biophys 272(1):203-9
Function/Process Mutants/Phenotypes	Huffaker TC and Robbins PW (1983) Yeast mutants deficient in protein glycosylation. Proc Natl Acad Sci U S A 80(24):7466-70	|ALG1 |ALG3 |ALG5 |ALG6 |SEC53

Return to SGD

Send a Message to the SGD Curators