---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

PRM8/YGL053W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVII: 402592 to 403305 CDS: 402592 - 403305 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
PRM8	YGL053W		ORF, Verified	S000003021
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 2000-09-05. Gene name expires on 2001-09-05.
Description
Pheromone-regulated protein with 2 predicted transmembrane segments and an FF sequence, a motif involved in COPII binding; forms a complex with Prp9p in the ER; member of DUP240 gene family

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2001-01-19 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By biological_process unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2009-08-24 SGD transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB vesicle-mediated transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0931 Assigned on 2008-02-14 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113      IDA : Inferred from Direct Assay Assigned on 2003-09-18 SGD Poirey R, et al. (2002) Functional analysis of the Saccharomyces cerevisiae DUP240 multigene family reveals membrane-associated proteins that are not essential for cell viability. Microbiology 148(Pt 7):2111-23        IMP : Inferred from Mutant Phenotype Assigned on 2008-03-10 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0095 Assigned on 2008-02-13 UniProtKB integral to membrane Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30        ISS : Inferred from Sequence or structural Similarity Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB plasma membrane Poirey R, et al. (2002) Functional analysis of the Saccharomyces cerevisiae DUP240 multigene family reveals membrane-associated proteins that are not essential for cell viability. Microbiology 148(Pt 7):2111-23        IMP : Inferred from Mutant Phenotype Assigned on 2008-03-10 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forPRM8/YGL053W for PRM8 1) Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30        2) Feuermann M, et al. (1997) The characterization of two new clusters of duplicated genes suggests a 'Lego' organization of the yeast Saccharomyces cerevisiae chromosomes. Yeast 13(9):861-9        3) Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113      4) Poirey R, et al. (2002) Functional analysis of the Saccharomyces cerevisiae DUP240 multigene family reveals membrane-associated proteins that are not essential for cell viability. Microbiology 148(Pt 7):2111-23

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PRM8/YGL053W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PRM8/YGL053W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MQTPSEN C-term PGVDEFF Length(aa) 237 MW(Da) 27,250 pI 4.86 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.028   Codon Adaptation Index 0.128   Frequency of Optimal Codons 0.437   Hydropathicity of Protein -0.223   Aromaticity Score 0.131	10 20 30 40 50 | | | | | MQTPSENTNAKSDSLDEPGAYLIEENVALPKDIFHSYLSYWIYEAAHCTP VMLLSLVIGVLISIIILFHDNENCVGVSVGFLLIFSGILVIVLILRFGPQ ISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQYLFDNDLWNTPYYFY RDEDCHRYFLSLIKGRTFKKQKESSASNVKDAQSNDETAGTPNEAAESSS FSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVDEFF*

Protein Structures from PDB: proteins of known structure with sequence similarity to PRM8/YGL053W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
PRM8	2000-10-30	Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YGL053W	SGD Systematic Sequence
852828	NCBI: Gene ID
NP_011462.1	NCBI: RefSeq protein version ID
NP_011462.1	NCBI: RefSeq protein version ID
6321385	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
10 curated references; 0 references not yet curated
Evolution Fungal Related Genes/Proteins	Katju V, et al. (2009) Variation in gene duplicates with low synonymous divergence in Saccharomyces cerevisiae relative to Caenorhabditis elegans. Genome Biol 10(7):R75	|AAD15 |AAD3 |ANB1 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |BUD5 |COS1 |COS5 |CUP1-1 |CUP1-2 |DOG1 |DOG2 |MORE
Regulation of Transcription	Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461	|AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
Fungal Related Genes/Proteins	Despons L, et al. (2006) An evolutionary scenario for one of the largest yeast gene families. Trends Genet 22(1):10-5	|COS1 |COS10 |COS12 |COS2 |COS3 |COS4 |COS5 |COS6 |COS7 |COS8 |COS9 |ECM34 |MST27 |MST28 |MORE
DNA/RNA Sequence Features Fungal Related Genes/Proteins Mapping	Leh-Louis V, et al. (2004) Expansion and contraction of the DUP240 multigene family in Saccharomyces cerevisiae populations. Genetics 167(4):1611-9	|MST27 |MST28 |PRM9 |UIP3 |YAR028W |YAR029W
Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions	Miller EA, et al. (2003) Multiple cargo binding sites on the COPII subunit Sec24p ensure capture of diverse membrane proteins into transport vesicles. Cell 114(4):497-509	|BET1 |BOS1 |EMP24 |EMP47 |ERP1 |ERP2 |GAP1 |SEC13 |SEC22 |SEC23 |SEC24 |SEC31 |SED5 |SFB2 |MORE
Cellular Location Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113	|COP1 |GEA2 |MST27 |MST28 |PRM9 |SEC21 |SEC23 |SEC24
Cellular Location DNA/RNA Sequence Features Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein-Nucleic Acid Interactions Protein-protein Interactions Strains/Constructs Techniques and Reagents	Poirey R, et al. (2002) Functional analysis of the Saccharomyces cerevisiae DUP240 multigene family reveals membrane-associated proteins that are not essential for cell viability. Microbiology 148(Pt 7):2111-23	|AGP3 |AVT3 |CWH41 |DTR1 |FIR1 |MCH4 |MST27 |MST28 |NIS1 |PAN1 |PRM9 |RGT2 |TPO1 |UIP3 |MORE
Function/Process Protein Sequence Features Regulation of	Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30	|AGA1 |PRM1 |PRM10 |PRM2 |PRM3 |PRM4 |PRM5 |PRM6 |PRM7 |PRM9
Mutants/Phenotypes Strains/Constructs	Winzeler EA, et al. (1999) Whole genome genetic-typing in yeast using high-density oligonucleotide arrays. Parasitology 118 Suppl:S73-80	|ARN2 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |ATS1 |AYT1 |BDS1 |COS6 |COS7 |COS8 |FLO1 |FMP32 |HXT9 |MORE
DNA/RNA Sequence Features Fungal Related Genes/Proteins	Feuermann M, et al. (1997) The characterization of two new clusters of duplicated genes suggests a 'Lego' organization of the yeast Saccharomyces cerevisiae chromosomes. Yeast 13(9):861-9	|MST28 |PRM9 |RNA15 |RPT6 |UIP3 |YAR028W |YAR029W

Return to SGD

Send a Message to the SGD Curators