---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

MST27/YGL051W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVII: 403690 to 404394 CDS: 403690 - 404394 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
MST27	YGL051W		ORF, Verified	S000003019
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 2003-04-29. Gene name expires on 2004-04-29.
Description
Putative integral membrane protein, involved in vesicle formation; forms complex with Mst28p; member of DUP240 gene family; binds COPI and COPII vesicles

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By protein binding Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113      IDA : Inferred from Direct Assay Assigned on 2003-09-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB vesicle organization Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113      IPI : Inferred from Physical Interaction IGI : Inferred from Genetic Interaction Assigned on 2003-09-18 SGD vesicle-mediated transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0931 Assigned on 2008-02-14 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By Golgi apparatus Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113      IDA : Inferred from Direct Assay Assigned on 2003-09-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0333 Assigned on 2008-02-14 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0132 Assigned on 2008-02-13 UniProtKB cytoplasmic vesicle GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0968 Assigned on 2009-06-29 UniProtKB endoplasmic reticulum Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113      IDA : Inferred from Direct Assay Assigned on 2003-09-18 SGD Poirey R, et al. (2002) Functional analysis of the Saccharomyces cerevisiae DUP240 multigene family reveals membrane-associated proteins that are not essential for cell viability. Microbiology 148(Pt 7):2111-23        IMP : Inferred from Mutant Phenotype Assigned on 2008-03-10 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0095 Assigned on 2008-02-13 UniProtKB integral to membrane Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113      IDA : Inferred from Direct Assay Assigned on 2003-09-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB plasma membrane Poirey R, et al. (2002) Functional analysis of the Saccharomyces cerevisiae DUP240 multigene family reveals membrane-associated proteins that are not essential for cell viability. Microbiology 148(Pt 7):2111-23        IMP : Inferred from Mutant Phenotype Assigned on 2008-03-10 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forMST27/YGL051W for MST27 1) Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113      2) Poirey R, et al. (2002) Functional analysis of the Saccharomyces cerevisiae DUP240 multigene family reveals membrane-associated proteins that are not essential for cell viability. Microbiology 148(Pt 7):2111-23

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for MST27/YGL051W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for MST27/YGL051W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MQTPLES C-term ALLKKTE Length(aa) 234 MW(Da) 27,241 pI 8.11 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.005   Codon Adaptation Index 0.104   Frequency of Optimal Codons 0.405   Hydropathicity of Protein -0.213   Aromaticity Score 0.124	10 20 30 40 50 | | | | | MQTPLESTDVKLDTLNEPSAHLIEKNVALPKDIFRSYLSYWIYEIARYTP VMILSLVIGVLVLLIIFFNDNEACVFNSAYYAYLSLVVLLIILGDGNPKL VSRRNFRTELLVDVITRKPAVEGKEWRIITYNMNQYLFNHGQWHTPYYFY SDEDCYRYFLRLVEGVTPKKQTATSIGNSPVTAKPEDAIESASPSSRLNY RNFLLKAAEIERQAQENYWRRRHPNIDALLKKTE*

Protein Structures from PDB: proteins of known structure with sequence similarity to MST27/YGL051W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
MST27	2003-09-18	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YGL051W	SGD Systematic Sequence
852830	NCBI: Gene ID
NP_011464.1	NCBI: RefSeq protein version ID
NP_011464.1	NCBI: RefSeq protein version ID
6321387	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
9 curated references; 0 references not yet curated
Evolution Fungal Related Genes/Proteins	Katju V, et al. (2009) Variation in gene duplicates with low synonymous divergence in Saccharomyces cerevisiae relative to Caenorhabditis elegans. Genome Biol 10(7):R75	|AAD15 |AAD3 |ANB1 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |BUD5 |COS1 |COS5 |CUP1-1 |CUP1-2 |DOG1 |DOG2 |MORE
Protein-protein Interactions	Pitre S, et al. (2008) Global investigation of protein-protein interactions in yeast Saccharomyces cerevisiae using re-occurring short polypeptide sequences. Nucleic Acids Res 36(13):4286-94	|HTZ1 |MST28 |SLY41 |TPO5 |UIP3 |YAR028W |YCR007C |YDL012C |YLR065C
Fungal Related Genes/Proteins	Despons L, et al. (2006) An evolutionary scenario for one of the largest yeast gene families. Trends Genet 22(1):10-5	|COS1 |COS10 |COS12 |COS2 |COS3 |COS4 |COS5 |COS6 |COS7 |COS8 |COS9 |ECM34 |MST28 |PRM8 |MORE
DNA/RNA Sequence Features RNA Levels and Processing Regulation of Transcription	Slattery MG, et al. (2006) The function and properties of the Azf1 transcriptional regulator change with growth conditions in Saccharomyces cerevisiae. Eukaryot Cell 5(2):313-20	|ADK2 |ADY3 |AIM20 |ANS1 |AQR1 |ARI1 |AZF1 |CIS3 |CLN1 |CLN3 |CPA1 |CRF1 |CSI2 |CYS3 |MORE
Protein-protein Interactions	Miller JP, et al. (2005) Large-scale identification of yeast integral membrane protein interactions. Proc Natl Acad Sci U S A 102(34):12123-8	|ARV1 |EMP24 |EMP46 |EMP47 |ERD1 |ERD2 |ERG11 |ERP5 |ERV29 |ERV41 |PHO84 |PHO88 |SEC61 |SHR3 |MORE
DNA/RNA Sequence Features Fungal Related Genes/Proteins Mapping	Leh-Louis V, et al. (2004) Expansion and contraction of the DUP240 multigene family in Saccharomyces cerevisiae populations. Genetics 167(4):1611-9	|MST28 |PRM8 |PRM9 |UIP3 |YAR028W |YAR029W
Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113	|COP1 |GEA2 |MST28 |PRM8 |PRM9 |SEC21 |SEC23 |SEC24
Cellular Location DNA/RNA Sequence Features Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein-Nucleic Acid Interactions Protein-protein Interactions Strains/Constructs Techniques and Reagents	Poirey R, et al. (2002) Functional analysis of the Saccharomyces cerevisiae DUP240 multigene family reveals membrane-associated proteins that are not essential for cell viability. Microbiology 148(Pt 7):2111-23	|AGP3 |AVT3 |CWH41 |DTR1 |FIR1 |MCH4 |MST28 |NIS1 |PAN1 |PRM8 |PRM9 |RGT2 |TPO1 |UIP3 |MORE
Mutants/Phenotypes Strains/Constructs	Winzeler EA, et al. (1999) Whole genome genetic-typing in yeast using high-density oligonucleotide arrays. Parasitology 118 Suppl:S73-80	|ARN2 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |ATS1 |AYT1 |BDS1 |COS6 |COS7 |COS8 |FLO1 |FMP32 |HXT9 |MORE

Return to SGD

Send a Message to the SGD Curators