---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ERG4/YGL012W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVII: 472860 to 474281 CDS: 472860 - 474281 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ERG4	YGL012W		ORF, Verified	S000002980
Description
C-24(28) sterol reductase, catalyzes the final step in ergosterol biosynthesis; mutants are viable, but lack ergosterol

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By delta24(24-1) sterol reductase activity Zweytick D, et al. (2000) Biochemical characterization and subcellular localization of the sterol C-24(28) reductase, erg4p, from the yeast saccharomyces cerevisiae. FEBS Lett 470(1):83-7        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:1.3.1.71 Assigned on 2007-05-23 UniProtKB oxidoreductase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By ergosterol biosynthetic process Zweytick D, et al. (2000) Biochemical characterization and subcellular localization of the sterol C-24(28) reductase, erg4p, from the yeast saccharomyces cerevisiae. FEBS Lett 470(1):83-7        TAS : Traceable Author Statement Assigned on 2001-01-18 SGD lipid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0444 Assigned on 2007-05-23 UniProtKB oxidation reduction GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2008-05-21 UniProtKB steroid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0752 Assigned on 2007-05-23 UniProtKB sterol biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0756 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Zweytick D, et al. (2000) Biochemical characterization and subcellular localization of the sterol C-24(28) reductase, erg4p, from the yeast saccharomyces cerevisiae. FEBS Lett 470(1):83-7        IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001171 Assigned on 2009-06-17 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
ergosterol biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ERG4/YGL012W for ERG4 ERG4 encodes sterol C-24(28) reductase, which catalyzes the final step in ergosterol biosynthesis (1, 2, 3, 4). Cells lacking ERG4 are viable, but lack ergosterol and are sensitive to several drugs (1, 5, 6). A mutation in ERG4 increases expression of ERG3, which encodes another enzyme involved in ergosterol biosynthesis (7). The S. pombe gene sts1 encodes a protein similar to Erg4p (8). Last Updated: 2000-09-06

Basic References [TOP]

BASIC INFORMATION REFERENCES forERG4/YGL012W for ERG4 1) Zweytick D, et al. (2000) Biochemical characterization and subcellular localization of the sterol C-24(28) reductase, erg4p, from the yeast saccharomyces cerevisiae. FEBS Lett 470(1):83-7        2) Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    3) Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6      4) Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30      5) Sauer B (1992) Identification of cryptic lox sites in the yeast genome by selection for Cre-mediated chromosome translocations that confer multiple drug resistance. J Mol Biol 223(4):911-28      6) Kaur R and Bachhawat AK (1999) The yeast multidrug resistance pump, Pdr5p, confers reduced drug resistance in erg mutants of Saccharomyces cerevisiae. Microbiology 145 ( Pt 4)():809-18        7) Arthington-Skaggs BA, et al. (1996) Positive and negative regulation of a sterol biosynthetic gene (ERG3) in the post-squalene portion of the yeast ergosterol pathway. FEBS Lett 392(2):161-5        8) Shimanuki M, et al. (1992) Fission yeast sts1+ gene encodes a protein similar to the chicken lamin B receptor and is implicated in pleiotropic drug-sensitivity, divalent cation-sensitivity, and osmoregulation. Mol Biol Cell 3(3):263-73

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERG4/YGL012W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERG4/YGL012W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MAKDNSE C-term VFIPYVF Length(aa) 473 MW(Da) 56,039 pI 8.77 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.282   Codon Adaptation Index 0.230   Frequency of Optimal Codons 0.578   Hydropathicity of Protein 0.125   Aromaticity Score 0.205

10 20 30 40 50 | | | | | MAKDNSEKLQVQGEEKKSKQPVNFLPQGKWLKPNEIEYEFGGTTGVIGML IGFPLLMYYMWICAEFYHGKVALPKAGESWMHFIKHLYQLVLENGIPEKY DWTIFLTFWVFQIIFYYTLPGIWTKGQPLSHLKGKQLPYFCNAMWTLYVT TTLVLVLHFTNLFRLYVIIDRFGRIMTCAIISGFAFSIILYLWTLFISHD YHRMTGNHLYDFFMGAPLNPRWGILDLKMFFEVRLPWFTLYFITLGACLK QWETYGYVTPQLGVVMLAHWLYANACAKGEELIVPTWDMAYEKFGFMLIF WNIAGVPYTYCHCTLYLYYHDPSEYHWSTLYNVSLYVVLLCAYYFFDTAN AQKNAFRKQMSGDKTGRKTFPFLPYQILKNPKYMVTSNGSYLLIDGWYTL ARKIHYTADWTQSLVWALSCGFNSVFPWFFPVFFLVVLIHRAFRDQAKCK RKYGKDWDEYCKHCPYVFIPYVF*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERG4/YGL012W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ERG4	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YGL012W	SGD Systematic Sequence
852872	NCBI: Gene ID
NP_011503.1	NCBI: RefSeq protein version ID
NP_011503.1	NCBI: RefSeq protein version ID
6321426	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
64 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes	Hodg CA, et al. (2010) Integral membrane proteins Brr6 and Apq12 link assembly of the nuclear pore complex to lipid homeostasis in the endoplasmic reticulum. J Cell Sci 123(Pt 1):141-151	|ACC1 |APQ12 |ARE1 |ARE2 |ARV1 |BRR6 |DGA1 |ELO1 |ERG2 |ERG3 |ERG5 |ERG6 |FEN1 |LRO1 |MORE
Regulation of	Zeng T and Li J (2010) Maximization of negative correlations in time-course gene expression data for enhancing understanding of molecular pathways. Nucleic Acids Res 38(1):e1	|ACO2 |ADR1 |CAB2 |CAT8 |CIT1 |ERG2 |ERG26 |ERG27 |ERG5 |ERG6 |GCN4 |GTT1 |HAP1 |HAP3 |MORE
Mutants/Phenotypes Strains/Constructs	Abe F and Hiraki T (2009) Mechanistic role of ergosterol in membrane rigidity and cycloheximide resistance in Saccharomyces cerevisiae. Biochim Biophys Acta 1788(3):743-52	|ERG2 |ERG3 |ERG5 |ERG6 |PDR5 |UPC2
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Daicho K, et al. (2009) Sorting defects of the tryptophan permease Tat2 in an erg2 yeast mutant. FEMS Microbiol Lett 298(2):218-27	|ERG2 |ERG3 |ERG5 |ERG6 |TAT2 |TRP1
Mutants/Phenotypes Strains/Constructs	Jones L, et al. (2009) Cdc42p is activated during vacuole membrane fusion in a sterol-dependent subreaction of priming. J Biol Chem	|CDC42 |ERG2 |ERG3 |ERG5 |ERG6 |RDI1 |SEC17 |SEC18 |STE20
Protein-protein Interactions Strains/Constructs	Lin M, et al. (2009) Modulation of sterol homeostasis by the Cdc42p effectors Cla4p and Ste20p in the yeast Saccharomyces cerevisiae. FEBS J 276(24):7253-64	|ARE1 |ARE2 |BEM1 |CBR1 |CLA4 |CLN1 |NCP1 |STE20 |SWE1
RNA Levels and Processing Regulation of	Roberts GG 3rd and Hudson AP (2009) Rsf1p is required for an efficient metabolic shift from fermentative to glycerol-based respiratory growth in S. cerevisiae. Yeast 26(2):95-110	|ABC1 |ACH1 |AEP2 |AGP2 |AGX1 |AHP1 |AIM33 |AIM39 |ANB1 |ARN1 |ARN2 |ATG3 |ATP1 |ATP10 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Wei M, et al. (2009) Tor1/Sch9-regulated carbon source substitution is as effective as calorie restriction in life span extension. PLoS Genet 5(5):e1000467	|DAK1 |DAK2 |ERG28 |ERG5 |FMP45 |GCY1 |GIS1 |GPD1 |GPD2 |GRE1 |HOR2 |IME1 |RAS1 |RAS2 |MORE
RNA Levels and Processing Regulation of	Guo N, et al. (2008) Global gene expression profile of Saccharomyces cerevisiae induced by dictamnine. Yeast 25(9):631-41	|ADE1 |ADE12 |ADE13 |ADE16 |ADE17 |ADE2 |ADE4 |ADE5,7 |ADE6 |ADE8 |ADY2 |APT1 |CBF1 |CIS3 |MORE
Fungal Related Genes/Proteins	Iwaki T, et al. (2008) Multiple functions of ergosterol in the fission yeast Schizosaccharomyces pombe. Microbiology 154(Pt 3):830-41	|ERG2 |ERG3 |ERG5 |ERG6
Reviews	Nagy PD (2008) Yeast as a model host to explore plant virus-host interactions. Annu Rev Phytopathol 46:217-42	|ADA2 |CHO2 |DED1 |ERG25 |FAS2 |INO2 |LSM1 |MCT1 |NGL2 |OLE1 |PAT1 |POX1 |SIN3 |SNF6 |MORE
Genetic Interactions Infection and Antifungals Mutants/Phenotypes Strains/Constructs	Welscher YM, et al. (2008) Natamycin Blocks Fungal Growth by Binding Specifically to Ergosterol without Permeabilizing the Membrane. J Biol Chem 283(10):6393-401	|ERG2 |ERG3 |ERG5 |ERG6
Function/Process Substrates/Ligands/Cofactors	He X, et al. (2007) Ergosterol production from molasses by genetically modified Saccharomyces cerevisiae. Appl Microbiol Biotechnol 75(1):55-60
Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Tiedje C, et al. (2007) Proteins involved in sterol synthesis interact with Ste20 and regulate cell polarity. J Cell Sci 120(Pt 20):3613-24	|BEM1 |CBR1 |CLA4 |CLN1 |FUS1 |LTE1 |NCP1 |OCH1 |STE20 |SWE1
Genetic Interactions Strains/Constructs	Tiwari R, et al. (2007) An acetylation/deacetylation cycle controls the export of sterols and steroids from S. cerevisiae. EMBO J 26(24):5109-19	|ATF1 |ATF2 |PDR5 |SAY1 |SNQ2
Large-scale phenotype analysis	Yadav J, et al. (2007) A phenomics approach in yeast links proton and calcium pump function in the Golgi. Mol Biol Cell 18(4):1480-9	|CUP5 |ERG2 |ERG3 |ERG6 |GAL11 |GCN4 |GCN5 |HFI1 |NHP10 |OPI1 |PMR1 |RPN4 |SAC1 |SET3 |MORE
RNA Levels and Processing	Guo Y, et al. (2006) Analysis of cellular responses to aflatoxin B(1) in yeast expressing human cytochrome P450 1A2 using cDNA microarrays. Mutat Res 593(1-2):121-42	|AAT1 |AHA1 |ALD2 |ALD3 |ALK1 |APC1 |APC5 |APT2 |AQR1 |AQY2 |ARC40 |ARN1 |ARO10 |ARO9 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Shobayashi M, et al. (2006) A new method for isolation of S-adenosylmethionine (SAM)-accumulating yeast. Appl Microbiol Biotechnol 69(6):704-10	|ERG6
Genetic Interactions Mutants/Phenotypes	Valachovic M, et al. (2006) Cumulative mutations affecting sterol biosynthesis in the yeast Saccharomyces cerevisiae result in synthetic lethality that is suppressed by alterations in sphingolipid profiles. Genetics 173(4):1893-908	|BCK2 |ECM22 |ERG2 |ERG28 |ERG5 |ERG6 |GDA1 |HAP1 |HDA3 |IES1 |RDN25-1 |RDN37-1 |RPN9 |SSN2 |MORE
RNA Levels and Processing	Brejning J, et al. (2005) Identification of genes and proteins induced during the lag and early exponential phase of lager brewing yeasts. J Appl Microbiol 98(2):261-71	|ADE17 |ADO1 |ALD6 |ASC1 |ENO2 |RHR2 |RPL25 |RPS15 |SAM1 |SBP1 |SSA2 |SSB1 |TMA19
Mutants/Phenotypes Strains/Constructs	Davies BS, et al. (2005) Dual activators of the sterol biosynthetic pathway of Saccharomyces cerevisiae: similar activation/regulatory domains but different response mechanisms. Mol Cell Biol 25(16):7375-85	|ECM22 |ERG2 |ERG3 |UPC2
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22	|ACB1 |ACC1 |ARE1 |ARE2 |AYR1 |CSG2 |DPL1 |ELO1 |ERG24 |ERG3 |ERG5 |FEN1 |HEM1 |IFA38 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kishimoto T, et al. (2005) Defects in structural integrity of ergosterol and the Cdc50p-Drs2p putative phospholipid translocase cause accumulation of endocytic membranes, onto which actin patches are assembled in yeast. Mol Biol Cell 16(12):5592-609	|ABP1 |ACT1 |BNI1 |CDC42 |CDC50 |DRS2 |ERG2 |ERG3 |ERG5 |ERG6 |GIC1 |LAS17 |SLA2 |SNC1
Protein-protein Interactions Techniques and Reagents	Mo C and Bard M (2005) A systematic study of yeast sterol biosynthetic protein-protein interactions using the split-ubiquitin system. Biochim Biophys Acta 1737(2-3):152-60	|ERG1 |ERG11 |ERG2 |ERG24 |ERG25 |ERG26 |ERG27 |ERG28 |ERG3 |ERG5 |ERG6 |ERG7 |ERG9
Function/Process Mutants/Phenotypes Strains/Constructs	Proszynski TJ, et al. (2005) A genome-wide visual screen reveals a role for sphingolipids and ergosterol in cell surface delivery in yeast. Proc Natl Acad Sci U S A 102(50):17981-6	|AYR1 |BUD27 |CCZ1 |CHS5 |ERG6 |FAB1 |GIM3 |KES1 |LCB1 |MCH5 |MON1 |OPI9 |PAC10 |RVS161 |MORE
Mutants/Phenotypes	Sano T, et al. (2005) Regulation of the sphingoid long-chain base kinase Lcb4p by ergosterol and heme: studies in phytosphingosine-resistant mutants. J Biol Chem 280(44):36674-82	|DPL1 |ERG2 |ERG3 |ERG5 |ERG6 |HAP1 |HEM14 |HMG1 |KES1 |LCB3 |LCB4 |PBP1 |PDR5 |TPS1 |MORE
Function/Process Genetic Interactions	Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19	|ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
RNA Levels and Processing Techniques and Reagents	Krantz M, et al. (2004) Anaerobicity prepares Saccharomyces cerevisiae cells for faster adaptation to osmotic shock. Eukaryot Cell 3(6):1381-90	|ALD2 |ALD3 |ALD4 |ALD6 |CTT1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |MORE
Mutants/Phenotypes	Lawrence CL, et al. (2004) Evidence of a new role for the high-osmolarity glycerol mitogen-activated protein kinase pathway in yeast: regulating adaptation to citric acid stress. Mol Cell Biol 24(8):3307-23	|ADE4 |AFT1 |AIM18 |AMS1 |ARO2 |BCK1 |BMH1 |BMH2 |BUB1 |CAX4 |CCH1 |CCW14 |CKA1 |CLC1 |MORE
Mutants/Phenotypes Strains/Constructs	Novotna D, et al. (2004) Different action of killer toxins K1 and K2 on the plasma membrane and the cell wall of Saccharomyces cerevisiae. FEMS Yeast Res 4(8):803-13	|GDA1 |KRE1 |KRE2 |SAC1 |VPS52 |VPS54
Regulation of Transcription	Agarwal AK, et al. (2003) Genome-wide expression profiling of the response to polyene, pyrimidine, azole, and echinocandin antifungal agents in Saccharomyces cerevisiae. J Biol Chem 278(37):34998-5015	|AGA1 |AMS1 |ATF2 |AUS1 |BAG7 |BAP2 |BAP3 |CRH1 |CTR1 |CWP1 |CYB5 |DAN1 |DAN4 |ELO1 |MORE
Function/Process Mutants/Phenotypes	Enyenihi AH and Saunders WS (2003) Large-scale functional genomic analysis of sporulation and meiosis in Saccharomyces cerevisiae. Genetics 163(1):47-54	|ADA2 |ADY2 |AKR1 |APS3 |APT1 |ARC1 |ARG82 |ARO2 |ATF1 |ATG11 |ATG15 |ATG16 |ATG5 |BPH1 |MORE
Function/Process Techniques and Reagents	He X, et al. (2003) Overexpression of a sterol C-24(28) reductase increases ergosterol production in Saccharomyces cerevisiae. Biotechnol Lett 25(10):773-8
Mutants/Phenotypes Strains/Constructs	Desmoucelles C, et al. (2002) Screening the yeast "disruptome" for mutants affecting resistance to the immunosuppressive drug, mycophenolic acid. J Biol Chem 277(30):27036-44	|ANP1 |BUD30 |CTK1 |CTK3 |DAL81 |DST1 |ERG24 |ERG3 |ERG5 |ERG6 |GCN5 |HOM2 |HPR1 |HTZ1 |MORE
Mutants/Phenotypes Strains/Constructs	Fleming JA, et al. (2002) Complementary whole-genome technologies reveal the cellular response to proteasome inhibition by PS-341. Proc Natl Acad Sci U S A 99(3):1461-6	|APN1 |ATG17 |BEM4 |BIK1 |CCR4 |CDC26 |CHL1 |CHL4 |CLB2 |CLB5 |CSM3 |CTF19 |CTF8 |DCC1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	McDonough V, et al. (2002) Mutations in erg4 affect the sensitivity of Saccharomyces cerevisiae to medium-chain fatty acids. Biochim Biophys Acta 1581(3):109-18
Function/Process Mutants/Phenotypes Strains/Constructs	Mukhopadhyay K, et al. (2002) Drug susceptibilities of yeast cells are affected by membrane lipid composition. Antimicrob Agents Chemother 46(12):3695-705
DNA/RNA Sequence Features Regulation of Transcription	Iyer VR, et al. (2001) Genomic binding sites of the yeast cell-cycle transcription factors SBF and MBF. Nature 409(6819):533-8	|ABF1 |APN1 |BBP1 |BUD9 |CAP1 |CDC21 |CDC45 |CDC7 |CLA4 |CLB1 |CLB2 |CLB6 |CLD1 |CLN1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Kato M and Wickner W (2001) Ergosterol is required for the Sec18/ATP-dependent priming step of homotypic vacuole fusion. EMBO J 20(15):4035-40	|ERG3 |ERG5 |ERG6 |SEC17 |SEC18
Function/Process Mutants/Phenotypes Strains/Constructs	Muren E, et al. (2001) Identification of yeast deletion strains that are hypersensitive to brefeldin A or monensin, two drugs that affect intracellular transport. Yeast 18(2):163-72	|ALG12 |ALG9 |BRE1 |BRE2 |BRE4 |BRE5 |ENT4 |HOS2 |IRC20 |LEM3 |LSM1 |MON1 |MON2 |NOP6 |MORE
Protein Sequence Features	Romano JD and Michaelis S (2001) Topological and mutational analysis of Saccharomyces cerevisiae Ste14p, founding member of the isoprenylcysteine carboxyl methyltransferase family. Mol Biol Cell 12(7):1957-71	|CHO2 |ERG24 |OPI3 |STE14
Function/Process Mutants/Phenotypes Strains/Constructs	de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42	|AAD4 |AIM22 |ALG12 |ALK2 |ARE2 |ARG2 |ARP5 |ASI2 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |MORE
Mutants/Phenotypes Strains/Constructs	Hughes TR, et al. (2000) Widespread aneuploidy revealed by DNA microarray expression profiling. Nat Genet 25(3):333-7	|BIM1 |BUB1 |BUB3 |CMD1 |DIA2 |DIA4 |ECM1 |ECM18 |GIM4 |GLC7 |MCM1 |RAD27 |RML2 |RNR1 |MORE
Non-Fungal Related Genes/Proteins	Schrick K, et al. (2000) FACKEL is a sterol C-14 reductase required for organized cell division and expansion in Arabidopsis embryogenesis. Genes Dev 14(12):1471-84	|ERG24
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs	Zweytick D, et al. (2000) Biochemical characterization and subcellular localization of the sterol C-24(28) reductase, erg4p, from the yeast saccharomyces cerevisiae. FEBS Lett 470(1):83-7	|ERG6
Genomic expression study Regulation of	Dimster-Denk D, et al. (1999) Comprehensive evaluation of isoprenoid biosynthesis regulation in Saccharomyces cerevisiae utilizing the Genome Reporter Matrix. J Lipid Res 40(5):850-60	|ARE1 |ARE2 |BEM1 |BET2 |BET4 |BTS1 |CAT5 |CDC43 |COQ1 |COQ2 |COQ3 |COQ6 |COX10 |ERG1 |MORE
Mutants/Phenotypes Strains/Constructs	Kaur R and Bachhawat AK (1999) The yeast multidrug resistance pump, Pdr5p, confers reduced drug resistance in erg mutants of Saccharomyces cerevisiae. Microbiology 145 ( Pt 4)():809-18	|CHO1 |ERG2 |ERG3 |ERG6 |PDR5
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Non-Fungal Related Genes/Proteins	Silve S, et al. (1998) Human lamin B receptor exhibits sterol C14-reductase activity in Saccharomyces cerevisiae. Biochim Biophys Acta 1392(2-3):233-44	|ERG24
Mutants/Phenotypes Strains/Constructs	Arthington-Skaggs BA, et al. (1996) Positive and negative regulation of a sterol biosynthetic gene (ERG3) in the post-squalene portion of the yeast ergosterol pathway. FEBS Lett 392(2):161-5	|ARE1 |ARE2 |ERG2 |ERG3 |ERG5 |ERG6
Function/Process Mutants/Phenotypes Reviews	Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6	|ERG1 |ERG11 |ERG2 |ERG24 |ERG3 |ERG5 |ERG6 |ERG7 |ERG9 |FEN1 |FEN2
Reviews	Parks LW and Casey WM (1995) Physiological implications of sterol biosynthesis in yeast. Annu Rev Microbiol 49:95-116	|ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |ERG3 |ERG5 |ERG6 |ERG7 |ERG8 |MORE
Reviews	Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30	|ERG1 |ERG10 |ERG11 |ERG12 |ERG2 |ERG20 |ERG24 |ERG3 |ERG5 |ERG6 |ERG7 |ERG8 |ERG9 |HMG1 |MORE
Fungal Related Genes/Proteins	Smith S (1995) Cloning and sequence analysis of an ERG24 homolog from Schizosaccharomyces pombe. Gene 155(1):139-40	|ERG24
Alias Fungal Related Genes/Proteins	Lai MH, et al. (1994) The identification of a gene family in the Saccharomyces cerevisiae ergosterol biosynthesis pathway. Gene 140(1):41-9	|ERG2 |ERG24
Reviews	Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|ACC1 |ACH1 |CDS1 |CHO1 |CHO2 |CKI1 |CTR1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |MORE
Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Sauer B (1992) Identification of cryptic lox sites in the yeast genome by selection for Cre-mediated chromosome translocations that confer multiple drug resistance. J Mol Biol 223(4):911-28	|SCL1
Fungal Related Genes/Proteins	Shimanuki M, et al. (1992) Fission yeast sts1+ gene encodes a protein similar to the chicken lamin B receptor and is implicated in pleiotropic drug-sensitivity, divalent cation-sensitivity, and osmoregulation. Mol Biol Cell 3(3):263-73
Function/Process	Chen WN, et al. (1991) The YGL022 gene encodes a putative transport protein. Yeast 7(3):305-8
Other Features	Kamilova TA and Ekhvalova TV (1989) [Resistance of yeasts to polyene antibiotics] Genetika 25(9):1705-7	|ERG3
Regulation of	Parks LW, et al. (1978) Sterols in yeast subcellular fractions. Lipids 13(10):730-5	|ERG24 |ERG6
Function/Process Protein Processing/Modification/Regulation	Pierce HD Jr, et al. (1978) Azasterol inhibitors in yeast. Inhibition of the 24-methylene sterol delta24(28)-reductase and delta24-sterol methyltransferase of Saccharomyces cerevisiae by 23-azacholesterol. Biochim Biophys Acta 529(3):429-37	|ERG6
Function/Process Protein Physical Properties Substrates/Ligands/Cofactors	Neal WD and Parks LW (1977) Sterol 24(28) methylene reductase in Saccharomyces cerevisiae. J Bacteriol 129(3):1375-8
Regulation of	Shimizu I and Katsuki H (1975) Effect of temperature on ergosterol biosynthesis in yeast. J Biochem 77(5):1023-7	|ERG1 |ERG10 |ERG11 |ERG13 |HMG1 |HMG2

Return to SGD

Send a Message to the SGD Curators