---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ERG26/YGL001C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrVII: 496506 to 495457 CDS: 496506 - 495457 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ERG26	YGL001C		ORF, Verified	S000002969
Description
C-3 sterol dehydrogenase, catalyzes the second of three steps required to remove two C-4 methyl groups from an intermediate in ergosterol biosynthesis

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By 3-beta-hydroxy-delta5-steroid dehydrogenase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002225 Assigned on 2008-02-13 UniProtKB C-3 sterol dehydrogenase (C-4 sterol decarboxylase) activity Gachotte D, et al. (1998) Characterization of the Saccharomyces cerevisiae ERG26 gene encoding the C-3 sterol dehydrogenase (C-4 decarboxylase) involved in sterol biosynthesis. Proc Natl Acad Sci U S A 95(23):13794-9        IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR016040 Assigned on 2008-02-13 UniProtKB catalytic activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR016040 Assigned on 2008-02-13 UniProtKB oxidoreductase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2007-05-23 UniProtKB sterol-4-alpha-carboxylate 3-dehydrogenase (decarboxylating) activity GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:1.1.1.170 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By alcohol metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT cellular lipid metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT ergosterol biosynthetic process Gachotte D, et al. (1998) Characterization of the Saccharomyces cerevisiae ERG26 gene encoding the C-3 sterol dehydrogenase (C-4 decarboxylase) involved in sterol biosynthesis. Proc Natl Acad Sci U S A 95(23):13794-9        IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD lipid biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0444 Assigned on 2007-05-23 UniProtKB metabolic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR016040 Assigned on 2008-02-13 UniProtKB oxidation reduction GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0560 Assigned on 2008-05-21 UniProtKB steroid biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002225 Assigned on 2008-02-13 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0752 Assigned on 2008-02-14 UniProtKB sterol biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0756 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Baudry K, et al. (2001) The effect of the erg26-1 mutation on the regulation of lipid metabolism in Saccharomyces cerevisiae. J Biol Chem 276(16):12702-11        IDA : Inferred from Direct Assay Assigned on 2002-06-30 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2008-02-14 UniProtKB endoplasmic reticulum membrane Mo C, et al. (2002) Protein-protein interactions among C-4 demethylation enzymes involved in yeast sterol biosynthesis. Proc Natl Acad Sci U S A 99(15):9739-44        IDA : Inferred from Direct Assay Assigned on 2002-08-19 SGD extrinsic to membrane GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9903 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
ergosterol biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ERG26/YGL001C for ERG26 ERG26 encodes C-3 sterol dehydrogenase, an enzyme that catalyzes the second of three steps required to remove two C-4 methyl groups from an intermediate in ergosterol biosynthesis (1, 2, 3, 4). The enzyme removes the 3-alpha-hydrogen, resulting in the decarboxylation of the 3-ketocarboxylic acid sterol intermediate (1). Cells lacking ERG26 are inviable (1). Mutations in ERG1, which encodes squalene monooxygenase, or in HEM1 or HEM3, which encode heme biosynthetic enzymes, can partially suppress the erg26 null phenotype. The erg26 hem1, erg26 hem3, and erg26 erg1 double mutants can grow if supplemented with ergosterol, and accumulate nonesterified carboxylic acid sterols (1). Last Updated: 2000-09-01

Basic References [TOP]

BASIC INFORMATION REFERENCES forERG26/YGL001C for ERG26 1) Gachotte D, et al. (1998) Characterization of the Saccharomyces cerevisiae ERG26 gene encoding the C-3 sterol dehydrogenase (C-4 decarboxylase) involved in sterol biosynthesis. Proc Natl Acad Sci U S A 95(23):13794-9        2) Paltauf F, et al. (1992) "Regulation and compartmentalization of lipid synthesis in yeast." Pp. 415-500 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Gene Expression, edited by Jones EW, Pringle JR and Broach JR. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    3) Lees ND, et al. (1995) Cloning of the late genes in the ergosterol biosynthetic pathway of Saccharomyces cerevisiae--a review. Lipids 30(3):221-6      4) Parks LW, et al. (1995) Biochemical and physiological effects of sterol alterations in yeast--a review. Lipids 30(3):227-30

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERG26/YGL001C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERG26/YGL001C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSKIDSV C-term AWMDEGL Length(aa) 349 MW(Da) 38,706 pI 6.67 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.153   Codon Adaptation Index 0.204   Frequency of Optimal Codons 0.504   Hydropathicity of Protein -0.162   Aromaticity Score 0.092	10 20 30 40 50 | | | | | MSKIDSVLIIGGSGFLGLHLIQQFFDINPKPDIHIFDVRDLPEKLSKQFT FNVDDIKFHKGDLTSPDDMENAINESKANVVVHCASPMHGQNPDIYDIVN VKGTRNVIDMCKKCGVNILVYTSSAGVIFNGQDVHNADETWPIPEVPMDA YNETKAIAEDMVLKANDPSSDFYTVALRPAGIFGPGDRQLVPGLRQVAKL GQSKFQIGDNNNLFDWTYAGNVADAHVLAAQKLLDPKTRTAVSGETFFIT NDTPTYFWALARTVWKADGHIDKHVIVLKRPVAICAGYLSEWVSKMLGKE PGLTPFRVKIVCAYRYHNIAKAKKLLGYTPRVGIEEGINKTLAWMDEGL*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERG26/YGL001C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to ERG26 Homolog Source (per PDB) Protein Alignment: ERG26 vs. Homolog External Links P-Value %Identical %Similar Alignment 2p5u ( Chain: A, D, B, C) Crystal structure of thermus thermophilus hb8 udp-glucose 4- epimerase complex with nad PDB_Info PDB_Structure Thermus thermophilus HB8 Chain A = 5.3e-10 28 31 View alignment SCOP MMDB CATH Chain D = 5.3e-10 28 31 View alignment Chain B = 5.3e-10 28 31 View alignment Chain C = 5.3e-10 28 31 View alignment 2p5y ( Chain: A) Crystal structure of thermus thermophilus hb8 udp-glucose 4- epimerase complex with nad PDB_Info PDB_Structure Thermus thermophilus HB8 5.3e-10 28 31 View alignment SCOP MMDB CATH 1sb9 ( Chain: A) Crystal structure of pseudomonas aeruginosa udp-n- acetylglucosamine 4-epimerase complexed with udp-glucose PDB_Info PDB_Structure Pseudomonas aeruginosa 2.5e-07 24 26 View alignment SCOP MMDB CATH 1sb8 ( Chain: A) Crystal structure of pseudomonas aeruginosa udp-n- acetylglucosamine 4-epimerase complexed with udp-n- acetylgalactosamine PDB_Info PDB_Structure Pseudomonas aeruginosa 2.5e-07 24 26 View alignment SCOP MMDB CATH 1i3n ( Chain: A, B) Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m- substituted udp-galactose 4-epimerase PDB_Info PDB_Structure Homo sapiens Chain A = 6.6e-07 24 31 View alignment SCOP MMDB CATH Chain B = 6.6e-07 24 31 View alignment 1i3m ( Chain: B, A) Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m- substituted udp-galactose 4-epimerase PDB_Info PDB_Structure Homo sapiens Chain B = 6.6e-07 24 31 View alignment SCOP MMDB CATH Chain A = 6.6e-07 24 31 View alignment 1i3l ( Chain: B, A) Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m- substituted udp-galactose 4-epimerase PDB_Info PDB_Structure Homo sapiens Chain B = 6.6e-07 24 31 View alignment SCOP MMDB CATH Chain A = 6.6e-07 24 31 View alignment 1i3k ( Chain: B, A) Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m- substituted udp-galactose 4-epimerase PDB_Info PDB_Structure Homo sapiens Chain B = 6.6e-07 24 31 View alignment SCOP MMDB CATH Chain A = 6.6e-07 24 31 View alignment 1ek5 ( Chain: A) Structure of human udp-galactose 4-epimerase in complex with nad+ PDB_Info PDB_Structure Homo sapiens 1.1e-06 24 31 View alignment SCOP MMDB CATH 1ek6 ( Chain: A, B) Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose PDB_Info PDB_Structure Homo sapiens Chain A = 1.1e-06 24 31 View alignment SCOP MMDB CATH Chain B = 1.1e-06 24 31 View alignment 1hzj ( Chain: B, A) Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site PDB_Info PDB_Structure Homo sapiens Chain B = 1.1e-06 24 31 View alignment SCOP MMDB CATH Chain A = 1.1e-06 24 31 View alignment 2c20 ( Chain: C, A, D, B, F, E) Crystal structure of udp-glucose 4-epimerase PDB_Info PDB_Structure Bacillus anthracis Chain C = 1.5e-06 24 30 View alignment SCOP MMDB CATH Chain A = 1.5e-06 24 30 View alignment Chain D = 1.5e-06 24 30 View alignment Chain B = 1.5e-06 24 30 View alignment Chain F = 1.5e-06 24 30 View alignment Chain E = 1.5e-06 24 30 View alignment 1nai ( Chain: A) Udp-galactose 4-epimerase from escherichia coli, oxidized PDB_Info PDB_Structure Escherichia coli 9.5e-06 25 29 View alignment SCOP MMDB CATH 1udb ( Chain: A) Structure of udp-galactose-4-epimerase complexed with udp-4- deoxy-4-fluoro-alpha-d-glucose PDB_Info PDB_Structure Escherichia coli 9.5e-06 25 29 View alignment SCOP MMDB CATH 1udc ( Chain: A) Structure of udp-galactose-4-epimerase complexed with udp- mannose PDB_Info PDB_Structure Escherichia coli 9.5e-06 25 29 View alignment SCOP MMDB CATH 1lrj ( Chain: A) Crystal structure of e. coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine PDB_Info PDB_Structure Escherichia coli 9.5e-06 25 29 View alignment SCOP MMDB CATH 1nah ( Chain: A) Udp-galactose 4-epimerase from escherichia coli, reduced PDB_Info PDB_Structure Escherichia coli 9.5e-06 25 29 View alignment SCOP MMDB CATH 2udp ( Chain: B, A) Udp-galactose 4-epimerase complexed with udp-phenol PDB_Info PDB_Structure Escherichia coli Chain B = 9.5e-06 25 29 View alignment SCOP MMDB CATH Chain A = 9.5e-06 25 29 View alignment 1lrl ( Chain: A) Crystal structure of udp-galactose 4-epimerase mutant y299c complexed with udp-glucose PDB_Info PDB_Structure Escherichia coli 9.5e-06 25 29 View alignment SCOP MMDB CATH 1uda ( Chain: A) Structure of udp-galactose-4-epimerase complexed with udp-4- deoxy-4-fluoro-alpha-d-galactose PDB_Info PDB_Structure Escherichia coli 9.5e-06 25 29 View alignment SCOP MMDB CATH 1xel ( Chain: A) Udp-galactose 4-epimerase from escherichia coli PDB_Info PDB_Structure Escherichia coli 9.5e-06 25 29 View alignment SCOP MMDB CATH 1lrk ( Chain: A) Crystal structure of escherichia coli udp-galactose 4- epimerase mutant y299c complexed with udp-n- acetylglucosamine PDB_Info PDB_Structure Escherichia coli 9.5e-06 25 29 View alignment SCOP MMDB CATH 1kvr ( Chain: A) Udp-galactose 4-epimerase complexed with udp-phenol PDB_Info PDB_Structure Escherichia coli 1.2e-05 25 29 View alignment SCOP MMDB CATH 1kvs ( Chain: A) Udp-galactose 4-epimerase complexed with udp-phenol PDB_Info PDB_Structure Escherichia coli 1.5e-05 25 29 View alignment SCOP MMDB CATH 1kvq ( Chain: A) Udp-galactose 4-epimerase complexed with udp-phenol PDB_Info PDB_Structure Escherichia coli 1.8e-05 25 29 View alignment SCOP MMDB CATH 1kvu ( Chain: A) Udp-galactose 4-epimerase complexed with udp-phenol PDB_Info PDB_Structure Escherichia coli 1.8e-05 25 29 View alignment SCOP MMDB CATH 1a9y ( Chain: A) Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp-glucose PDB_Info PDB_Structure Escherichia coli 2.4e-05 25 29 View alignment SCOP MMDB CATH 1ket ( Chain: A, B) The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound PDB_Info PDB_Structure Streptococcus suis Chain A = 2.6e-05 23 31 View alignment SCOP MMDB CATH Chain B = 2.6e-05 23 31 View alignment 1kep ( Chain: B, A) The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound PDB_Info PDB_Structure Streptococcus suis Chain B = 2.6e-05 23 31 View alignment SCOP MMDB CATH Chain A = 2.6e-05 23 31 View alignment 1oc2 ( Chain: B, A) The structure of nadh in the dtdp-d-glucose dehydratase (rmlb) enzyme PDB_Info PDB_Structure Streptococcus suis Chain B = 2.6e-05 23 31 View alignment SCOP MMDB CATH Chain A = 2.6e-05 23 31 View alignment 1ker ( Chain: A, B) The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-d-glucose bound PDB_Info PDB_Structure Streptococcus suis Chain A = 2.6e-05 23 31 View alignment SCOP MMDB CATH Chain B = 2.6e-05 23 31 View alignment 3dhn ( Chain: A) Crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310. PDB_Info PDB_Structure Bacteroides thetaiotaomicron 2.6e-05 27 34 View alignment SCOP MMDB CATH 1kvt ( Chain: A) Udp-galactose 4-epimerase complexed with udp-phenol PDB_Info PDB_Structure Escherichia coli 2.9e-05 25 29 View alignment SCOP MMDB CATH 3enk ( Chain: B, A) .9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei PDB_Info PDB_Structure Burkholderia pseudomallei 1710b Chain B = 3.0e-05 23 31 View alignment SCOP MMDB CATH Chain A = 3.0e-05 23 31 View alignment 1z45 ( Chain: A) Crystal structure of the gal10 fusion protein galactose mutarotase/udp-galactose 4-epimerase from saccharomyces cerevisiae complexed with nad, udp-glucose, and galactose PDB_Info PDB_Structure Saccharomyces cerevisiae 3.1e-05 26 29 View alignment SCOP MMDB CATH 1a9z ( Chain: A) Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp-galactose PDB_Info PDB_Structure Escherichia coli 3.4e-05 24 30 View alignment SCOP MMDB CATH 2p4h ( Chain: X) Crystal structure of vestitone reductase from alfalfa (medicago sativa l.) PDB_Info PDB_Structure Medicago sativa 6.0e-05 29 28 View alignment SCOP MMDB CATH 2hun ( Chain: B, A) Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3 PDB_Info PDB_Structure Pyrococcus horikoshii OT3 Chain B = 0.000100 24 32 View alignment SCOP MMDB CATH Chain A = 0.000100 24 32 View alignment 2pzj ( Chain: A) Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nad+ PDB_Info PDB_Structure Bordetella bronchiseptica 0.000200 23 28 View alignment SCOP MMDB CATH 2q1t ( Chain: A) Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nad+ and udp PDB_Info PDB_Structure Bordetella bronchiseptica 0.000200 23 28 View alignment SCOP MMDB CATH 2q1u ( Chain: A, B) Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nad+ and udp PDB_Info PDB_Structure Bordetella bronchiseptica Chain A = 0.000200 23 28 View alignment SCOP MMDB CATH Chain B = 0.000200 23 28 View alignment 2q1s ( Chain: A) Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nadh PDB_Info PDB_Structure Bordetella bronchiseptica 0.000200 23 28 View alignment SCOP MMDB CATH 1r6d ( Chain: A) Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with nad and dau bound PDB_Info PDB_Structure Streptomyces venezuelae 0.000200 21 34 View alignment SCOP MMDB CATH 2pzl ( Chain: A, B) Crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with nad and udp PDB_Info PDB_Structure Bordetella bronchiseptica Chain A = 0.000219 27 27 View alignment SCOP MMDB CATH Chain B = 0.000219 27 27 View alignment 2pzm ( Chain: A, B) Crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with nad and udp PDB_Info PDB_Structure Bordetella bronchiseptica Chain A = 0.000219 27 27 View alignment SCOP MMDB CATH Chain B = 0.000219 27 27 View alignment 2pzk ( Chain: B, A) Crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with nad PDB_Info PDB_Structure Bordetella bronchiseptica Chain B = 0.000219 27 27 View alignment SCOP MMDB CATH Chain A = 0.000219 27 27 View alignment 1r66 ( Chain: A) Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with nad and tyd bound PDB_Info PDB_Structure Streptomyces venezuelae 0.000270 21 34 View alignment SCOP MMDB CATH 3hfs ( Chain: A, B) Anthocyanidin reductase PDB_Info PDB_Structure Unknown Chain A = 0.000320 25 33 View alignment SCOP MMDB CATH Chain B = 0.000320 25 33 View alignment 2rh8 ( Chain: A) Structure of apo anthocyanidin reductase from vitis vinifera PDB_Info PDB_Structure Vitis vinifera 0.000320 25 33 View alignment SCOP MMDB CATH 1bxk ( Chain: A, B) Dtdp-glucose 4,6-dehydratase from e. coli PDB_Info PDB_Structure Escherichia coli Chain A = 0.001200 22 27 View alignment SCOP MMDB CATH Chain B = 0.001200 22 27 View alignment 1wvg ( Chain: B, A) Structure of cdp-d-glucose 4,6-dehydratase from salmonella typhi PDB_Info PDB_Structure Salmonella enterica subsp. enterica serovar typhi str. ct18 Chain B = 0.001200 22 29 View alignment SCOP MMDB CATH Chain A = 0.001200 22 29 View alignment 2b69 ( Chain: A) Crystal structure of human udp-glucoronic acid decarboxylase PDB_Info PDB_Structure Homo sapiens 0.001400 22 27 View alignment SCOP MMDB CATH 3gpi ( Chain: A) Structure of putative nad-dependent epimerase/dehydratase from methylobacillus flagellatus PDB_Info PDB_Structure Methylobacillus flagellatus KT 0.005097 25 30 View alignment SCOP MMDB CATH 2hrz ( Chain: A) The crystal structure of the nucleoside-diphosphate-sugar epimerase from agrobacterium tumefaciens PDB_Info PDB_Structure Agrobacterium tumefaciens str. C58 0.005599 26 30 View alignment SCOP MMDB CATH 2gn9 ( Chain: B, A) Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with nadp and udp-glc PDB_Info PDB_Structure Helicobacter pylori Chain B = 0.006697 21 33 View alignment SCOP MMDB CATH Chain A = 0.006697 21 33 View alignment 2gna ( Chain: A, B) Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with nadp and udp-gal PDB_Info PDB_Structure Helicobacter pylori Chain A = 0.006697 21 33 View alignment SCOP MMDB CATH Chain B = 0.006697 21 33 View alignment 2gn6 ( Chain: B, A) Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with nadp and udp-glcnac PDB_Info PDB_Structure Helicobacter pylori Chain B = 0.006697 21 33 View alignment SCOP MMDB CATH Chain A = 0.006697 21 33 View alignment 2gn4 ( Chain: A, B) Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with nadph and udp-glcnac PDB_Info PDB_Structure Helicobacter pylori Chain A = 0.006697 21 33 View alignment SCOP MMDB CATH Chain B = 0.006697 21 33 View alignment 2gn8 ( Chain: A, B) Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with nadp and udp PDB_Info PDB_Structure Helicobacter pylori Chain A = 0.006697 21 33 View alignment SCOP MMDB CATH Chain B = 0.006697 21 33 View alignment 3ehe ( Chain: A, B) Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus PDB_Info PDB_Structure Archaeoglobus fulgidus Chain A = 0.009400 24 36 View alignment SCOP MMDB CATH Chain B = 0.009400 24 36 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ERG26	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YGL001C	SGD Systematic Sequence
852883	NCBI: Gene ID
NP_011514.1	NCBI: RefSeq protein version ID
NP_011514.1	NCBI: RefSeq protein version ID
6321437	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
29 curated references; 0 references not yet curated
Other Features	Taramino S, et al. (2010) Interactions of oxidosqualene cyclase (Erg7p) with 3-keto reductase (Erg27p) and other enzymes of sterol biosynthesis in yeast. Biochim Biophys Acta 1801(2):156-162	|ERG25 |ERG27 |ERG7
Regulation of	Zeng T and Li J (2010) Maximization of negative correlations in time-course gene expression data for enhancing understanding of molecular pathways. Nucleic Acids Res 38(1):e1	|ACO2 |ADR1 |CAB2 |CAT8 |CIT1 |ERG2 |ERG27 |ERG4 |ERG5 |ERG6 |GCN4 |GTT1 |HAP1 |HAP3 |MORE
Reviews	Goodman JM (2009) Demonstrated and inferred metabolism associated with cytosolic lipid droplets. J Lipid Res 50(11):2148-56	|AYR1 |DGA1 |EHT1 |ERG1 |ERG27 |ERG6 |ERG7 |FAA1 |FAA4 |FAT1 |SLC1 |TGL1 |TGL3 |TGL4 |MORE
Regulation of Transcription	Rintala E, et al. (2009) Low oxygen levels as a trigger for enhancement of respiratory metabolism in Saccharomyces cerevisiae. BMC Genomics 10():461	|AAT2 |ACO1 |ACS1 |ADH1 |ADH2 |AFR1 |AGA1 |AGA2 |ALD4 |ALD6 |ANT1 |ARE1 |ARN1 |ASH1 |MORE
Evolution Non-Fungal Related Genes/Proteins	Szklarczyk R and Huynen MA (2009) Expansion of the human mitochondrial proteome by intra- and inter-compartmental protein duplication. Genome Biol 10(11):R135	|AAC1 |AAC3 |AAT2 |ABC1 |ACN9 |ACO1 |ACP1 |ADK1 |ADK2 |AGC1 |AHP1 |ALD4 |ALD5 |ALD6 |MORE
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Mutants/Phenotypes Strains/Constructs	Michelsen K, et al. (2007) Novel cargo-binding site in the beta and delta subunits of coatomer. J Cell Biol 179(2):209-17	|COP1 |DSL1 |PAC10 |PMP2 |RET2 |RET3 |RSC6 |SEC15 |SEC21 |SEC26 |SEC27 |SEC39 |SEC65 |SER33 |MORE
Cross-species Expression Non-Fungal Related Genes/Proteins	Rahier A, et al. (2006) Molecular and enzymatic characterizations of novel bifunctional 3beta-hydroxysteroid dehydrogenases/C-4 decarboxylases from Arabidopsis thaliana. J Biol Chem 281(37):27264-77
Fungal Related Genes/Proteins Mutants/Phenotypes	Snoek IS and Steensma HY (2006) Why does Kluyveromyces lactis not grow under anaerobic conditions? Comparison of essential anaerobic genes of Saccharomyces cerevisiae with the Kluyveromyces lactis genome. FEMS Yeast Res 6(3):393-403	|ACP1 |ARB1 |ARG82 |ARH1 |ARV1 |ATM1 |BTS1 |BUR6 |CAB2 |CAX4 |CDC40 |CNM67 |CTF4 |DBP7 |MORE
Cell Cycle Phase Involved Function/Process Mutants/Phenotypes Strains/Constructs	Yu L, et al. (2006) A survey of essential gene function in the yeast cell division cycle. Mol Biol Cell 17(11):4736-47	|ALA1 |CDC1 |CDC13 |CDC14 |CDC15 |CDC16 |CDC19 |CDC20 |CDC21 |CDC23 |CDC25 |CDC27 |CDC3 |CDC34 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Altmann K and Westermann B (2005) Role of essential genes in mitochondrial morphogenesis in Saccharomyces cerevisiae. Mol Biol Cell 16(11):5410-7	|ARC35 |ARC40 |ARP2 |BFR2 |CCT4 |CCT6 |CDC34 |CDC53 |COF1 |DSL1 |ERG1 |ERG10 |ERG12 |ERG13 |MORE
RNA Levels and Processing Regulation of	Kleinschmidt M, et al. (2005) Transcriptional profiling of Saccharomyces cerevisiae cells under adhesion-inducing conditions. Mol Genet Genomics 273(5):382-93	|AAD10 |APM3 |ARG1 |ARO10 |BAT2 |BIO3 |BRR2 |CPR6 |CUP1-1 |CUP1-2 |CWP2 |DDR48 |ECM22 |ERG12 |MORE
RNA Levels and Processing Regulation of	Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91	|AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE
Protein-protein Interactions Techniques and Reagents	Mo C and Bard M (2005) A systematic study of yeast sterol biosynthetic protein-protein interactions using the split-ubiquitin system. Biochim Biophys Acta 1737(2-3):152-60	|ERG1 |ERG11 |ERG2 |ERG24 |ERG25 |ERG27 |ERG28 |ERG3 |ERG4 |ERG5 |ERG6 |ERG7 |ERG9
Protein-protein Interactions	Mo C and Bard M (2005) Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex. J Lipid Res 46(9):1991-8	|ERG1 |ERG11 |ERG25 |ERG27 |ERG28 |ERG6
RNA Levels and Processing	Shobayashi M, et al. (2005) Effects of Culture Conditions on Ergosterol Biosynthesis by Saccharomyces cerevisiae. Biosci Biotechnol Biochem 69(12):2381-8	|ERG13 |ERG2 |ERG20 |ERG24 |ERG28 |ERG3 |ERG5 |ERG6 |HMG1
RNA Levels and Processing Regulation of	Jones DL, et al. (2004) Genome-Wide Analysis of the Effects of Heat Shock on a Saccharomyces cerevisiae Mutant With a Constitutively Activated cAMP-Dependent Pathway. Comp Funct Genomics 5(5):419-31	|BTN2 |COX6 |DCS1 |ENO1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG27 |ERG3 |ERG6 |MORE
RNA Levels and Processing Techniques and Reagents	Krantz M, et al. (2004) Anaerobicity prepares Saccharomyces cerevisiae cells for faster adaptation to osmotic shock. Eukaryot Cell 3(6):1381-90	|ALD2 |ALD3 |ALD4 |ALD6 |CTT1 |ERG1 |ERG10 |ERG11 |ERG12 |ERG13 |ERG2 |ERG20 |ERG24 |ERG25 |MORE
Cellular Location Function/Process Genetic Interactions Regulation of Reviews Substrates/Ligands/Cofactors	Mullner H and Daum G (2004) Dynamics of neutral lipid storage in yeast. Acta Biochim Pol 51(2):323-47	|ARE1 |ARE2 |DGA1 |LRO1 |TGL1 |TGL3
Regulation of Transcription	Agarwal AK, et al. (2003) Genome-wide expression profiling of the response to polyene, pyrimidine, azole, and echinocandin antifungal agents in Saccharomyces cerevisiae. J Biol Chem 278(37):34998-5015	|AGA1 |AMS1 |ATF2 |AUS1 |BAG7 |BAP2 |BAP3 |CRH1 |CTR1 |CWP1 |CYB5 |DAN1 |DAN4 |ELO1 |MORE
Cross-species Expression Non-Fungal Related Genes/Proteins	Lucas ME, et al. (2003) Identification of two novel mutations in the murine Nsdhl sterol dehydrogenase gene and development of a functional complementation assay in yeast. Mol Genet Metab 80(1-2):227-33
Cellular Location Function/Process Mutants/Phenotypes Protein Physical Properties Protein-protein Interactions Strains/Constructs	Mo C, et al. (2002) Protein-protein interactions among C-4 demethylation enzymes involved in yeast sterol biosynthesis. Proc Natl Acad Sci U S A 99(15):9739-44	|ERG25 |ERG27 |ERG28
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Swain E, et al. (2002) Sterol-dependent regulation of sphingolipid metabolism in Saccharomyces cerevisiae. J Biol Chem 277(29):26177-84	|CCC2 |LCB3 |SCS7 |SUR2
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Aaron KE, et al. (2001) The Candida albicans ERG26 gene encoding the C-3 sterol dehydrogenase (C-4 decarboxylase) is essential for growth. FEMS Yeast Res 1(2):93-101
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs Techniques and Reagents	Baudry K, et al. (2001) The effect of the erg26-1 mutation on the regulation of lipid metabolism in Saccharomyces cerevisiae. J Biol Chem 276(16):12702-11	|ERG25 |ERG27 |FEN1 |SUR4
Function/Process Other Features	Gachotte D, et al. (2001) A novel gene conserved from yeast to humans is involved in sterol biosynthesis. J Lipid Res 42(1):150-4	|ERG27 |ERG28
Function/Process Fungal Related Genes/Proteins	Gachotte D, et al. (1999) Characterization of the Saccharomyces cerevisiae ERG27 gene encoding the 3-keto reductase involved in C-4 sterol demethylation. Proc Natl Acad Sci U S A 96(22):12655-60	|ERG25 |ERG27
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |CSG2 |DPL1 |DPP1 |EPT1 |MORE
Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Gachotte D, et al. (1998) Characterization of the Saccharomyces cerevisiae ERG26 gene encoding the C-3 sterol dehydrogenase (C-4 decarboxylase) involved in sterol biosynthesis. Proc Natl Acad Sci U S A 95(23):13794-9	|ERG1 |ERG25 |HEM3

Return to SGD

Send a Message to the SGD Curators