---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

FCY22/YER060W-A Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrV: 276570 to 278162 CDS: 276570 - 278162 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
FCY22	YER060W-A		ORF, Verified	S000002958
Description
Putative purine-cytosine permease, very similar to Fcy2p but cannot substitute for its function

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By nucleobase transmembrane transporter activity Wagner R, et al. (2001) New plasmid system to select for Saccharomyces cerevisiae purine-cytosine permease affinity mutants. J Bacteriol 183(14):4386-8        ISS : Inferred from Sequence or structural Similarity Assigned on 2002-11-19 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001248 , EBI:IPR012681 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By nucleobase, nucleoside, nucleotide and nucleic acid transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001248 , EBI:IPR012681 Assigned on 2007-05-23 UniProtKB transmembrane transport Wagner R, et al. (2001) New plasmid system to select for Saccharomyces cerevisiae purine-cytosine permease affinity mutants. J Bacteriol 183(14):4386-8        ISS : Inferred from Sequence or structural Similarity Assigned on 2009-04-16 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001248 , EBI:IPR012681 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By integral to membrane Wagner R, et al. (2001) New plasmid system to select for Saccharomyces cerevisiae purine-cytosine permease affinity mutants. J Bacteriol 183(14):4386-8        ISS : Inferred from Sequence or structural Similarity Assigned on 2002-11-19 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR012681 , EBI:IPR001248 Assigned on 2009-06-17 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forFCY22/YER060W-A for FCY22 1) Wagner R, et al. (2001) New plasmid system to select for Saccharomyces cerevisiae purine-cytosine permease affinity mutants. J Bacteriol 183(14):4386-8

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for FCY22/YER060W-A

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for FCY22/YER060W-A

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MPEKLAM C-term ELKYFGR Length(aa) 530 MW(Da) 57,327 pI 4.94 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.170   Codon Adaptation Index 0.168   Frequency of Optimal Codons 0.497   Hydropathicity of Protein 0.521   Aromaticity Score 0.140

10 20 30 40 50 | | | | | MPEKLAMSMVDIKDAGSELRDLESGALDTKSSAADVYYEGVELHRTNEFI DNKPSFFNRIAAALNAETKGIEPVTEDEKNDDSILNAATIWFSANMVIVA YSVGALGPLVFGLNFGQSVLVIIFFNILGLIPVALFSLFGVELGLRQMIL SRYLAGNITARFFSLVNVIACVGWCVLNISVSAQLLNMVNEGSGHNCPIW AGCLIIAGGTVLVTFFGYSVVHAYEKWSWVPNFAAFLVIIAQLSRSGKFK GGEWVGGATTAGGVLSFGSSVFGSAAGWATYAADYTVYMPKTTSKYKIFF SVVAGLAFPLFFTMILGAACGMAALNDPTWKSYYDKNAMGGVIYAILVPN SLNGFGQFCCVLLALSTVANNVPGMYTVALSAQALWAPLAKIPRVVWTMA GNAATLGISIPATYYFDGFMENFMDSIGYYLAIYIAIACSEHFIYRRSFS AYNIDDWDNWEHLPIGIAGTAALIAGAFGVALGMCQTYWVGEISRLIGEY GGDIGFELGGSWAFIIYNIVRPLELKYFGR*

Protein Structures from PDB: proteins of known structure with sequence similarity to FCY22/YER060W-A, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
FCY22	SGD (2007) Information without a citation in SGD

Sequence Annotation Notes

Date	Note
1999-07-17	YER060W-A/FCY22 was originally incorrectly annotated as being identical to its neighboring ORF YER060W/FCY21, at coordinates 274565-276151 (1587 nucleotides long). This error has been corrected, and the coordinates of YER060W-A/FCY22 are now 276570-278162 (1593 nt). Sequence files have been updated accordingly.

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YER060W-A	SGD Systematic Sequence
856789	NCBI: Gene ID
NP_010982.1	NCBI: RefSeq protein version ID
NP_010982.1	NCBI: RefSeq protein version ID
6320903	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
5 curated references; 0 references not yet curated
Evolution Fungal Related Genes/Proteins	Hamari Z, et al. (2009) Convergent evolution and orphan genes in the Fur4p-like family and characterization of a general nucleoside transporter in Aspergillus nidulans. Mol Microbiol 73(1):43-57	|DAL4 |FCY2 |FCY21 |FUI1 |FUN26 |FUR4 |NRT1 |THI7 |THI72 |TPN1
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Substrates/Ligands/Cofactors	Paluszynski JP, et al. (2006) Various cytosine/adenine permease homologues are involved in the toxicity of 5-fluorocytosine in Saccharomyces cerevisiae. Yeast 23(9):707-15	|DAL4 |FCY1 |FCY2 |FCY21 |FUI1 |FUR4 |NRT1 |TPN1
Mutants/Phenotypes	Tucker CL and Fields S (2004) Quantitative genome-wide analysis of yeast deletion strain sensitivities to oxidative and chemical stress. Comp Funct Genomics 5(3):216-24	|ALF1 |APN2 |ARO1 |ARO2 |ASI1 |BAP2 |BCK1 |BPH1 |BST1 |CCP1 |CCS1 |COG1 |COG5 |CTR1 |MORE
Fungal Related Genes/Proteins	Wagner R, et al. (2001) New plasmid system to select for Saccharomyces cerevisiae purine-cytosine permease affinity mutants. J Bacteriol 183(14):4386-8	|FCY2 |FCY21

Return to SGD

Send a Message to the SGD Curators