SEC20/YDR498C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrIV: 1446987 to 1445836
CDS: 1446987 - 1445836

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

SEC20 YDR498C ORF, Verified S000002906

Description
Membrane glycoprotein v-SNARE involved in retrograde transport from the Golgi to the ER; required for N- and O-glycosylation in the Golgi but not in the ER; interacts with the Dsl1p complex through Tip20p

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
SNAP receptor activity Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ER-dependent peroxisome organization Perry RJ, et al. (2009) Endoplasmic Reticulum-Associated Secretory Proteins Sec20p, Sec39p, and Dsl1p Are Involved in Peroxisome Biogenesis. Eukaryot Cell 8(6):830-843
       IMP : Inferred from Mutant Phenotype
Assigned on 2009-05-15 SGD
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
retrograde vesicle-mediated transport, Golgi to ER Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
vesicle fusion Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
vesicle-mediated transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0931
Assigned on 2008-02-14 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Kumar A, et al. (2002) Subcellular localization of the yeast proteome. Genes Dev 16(6):707-19
             IDA : Inferred from Direct Assay
Assigned on 2002-05-07 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2009-10-01 UniProtKB
endoplasmic reticulum membrane Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9908
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
colocalizes_with peroxisome Perry RJ, et al. (2009) Endoplasmic Reticulum-Associated Secretory Proteins Sec20p, Sec39p, and Dsl1p Are Involved in Peroxisome Biogenesis. Eukaryot Cell 8(6):830-843
       IDA : Inferred from Direct Assay
Assigned on 2009-05-15 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forSEC20/YDR498C for SEC20
1) Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8

2) Schleip I, et al. (2001) The yeast SEC20 gene is required for N- and O-glycosylation in the Golgi. Evidence that impaired glycosylation does not correlate with the secretory defect. J Biol Chem 276(31):28751-8

3) Tripathi A, et al. (2009) Structural characterization of Tip20p and Dsl1p, subunits of the Dsl1p vesicle tethering complex. Nat Struct Mol Biol 16(2):114-23

4) Novick P and Schekman R (1979) Secretion and cell-surface growth are blocked in a temperature-sensitive mutant of Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 76(4):1858-62

5) Novick P, et al. (1980) Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SEC20/YDR498C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SEC20/YDR498C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MVVTFLQ

C-term IVSHDEL

Length(aa) 383

MW(Da) 43,882

pI 5.92

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.043

Codon Adaptation Index 0.140

Frequency of Optimal Codons 0.432

Hydropathicity of Protein -0.300

Aromaticity Score 0.084

10 20 30 40 50 | | | | | MVVTFLQDLEVLQDALLNNLQKLSAISRRKESGESKHDNKDSFAAIANEH NDEEEEIEFEDLVNIIESKVSDFESVLKCSIVEMTYKYPELKLQWEKSPR YDQCDKLHIVKLDKQMNEDIYAQLVEELDFVLQFVDWFYCYRLKVKEILR QHHKRDLAWNDEKRDRAIKFHAVDYDKLHQGTSSSSSLTSTSMEKASTRE KLLSKTKQLTNNLVRGNQILQSGILQSDLNLDELRAQTNSLTQIDDKYTQ FETVFKKTADLVKVLENASHQEKRDVYLSLGFLLCCVSWVLWRRIFKLPV KLGLWLLFKFFKGILVTLGLVKSYAGSSSSLQAPSLVLNAPILATTTTSS ATSVEPFASVSAVSSIQRAVDEAVDRIVSHDEL*

Protein Structures from PDB: proteins of known structure with sequence similarity to SEC20/YDR498C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
SEC20 Novick P, et al. (1980) Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15

Standard Name	Reference
SEC20	*Novick P, et al.* (1980)** Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YDR498C SGD Systematic Sequence

852109 NCBI: Gene ID

NP_010786.1 NCBI: RefSeq protein version ID

NP_010786.1 NCBI: RefSeq protein version ID

6320706 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YDR498C	SGD Systematic Sequence
852109	NCBI: Gene ID
NP_010786.1	NCBI: RefSeq protein version ID
NP_010786.1	NCBI: RefSeq protein version ID
6320706	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
44 curated references; 0 references not yet curated
Reviews
Nagotu S, et al. (2010) Divide et impera: the dictum of peroxisomes. Traffic 11(2):175-84
       |ARF1 |ARF3 |CAF4 |DNM1 |DSL1 |EMP24 |FIS1 |MDV1 |PEX11 |PEX2 |PEX3 |PEX30 |PEX31 |SEC39 |MORE
Cellular Location
Function/Process
Mutants/Phenotypes
Protein Processing/Modification/Regulation
Strains/Constructs
Perry RJ, et al. (2009) Endoplasmic Reticulum-Associated Secretory Proteins Sec20p, Sec39p, and Dsl1p Are Involved in Peroxisome Biogenesis. Eukaryot Cell 8(6):830-843
       |BOS1 |COP1 |DSL1 |PEX3 |POT1 |SEC1 |SEC11 |SEC12 |SEC13 |SEC14 |SEC17 |SEC18 |SEC21 |SEC26 |MORE
Protein Sequence Features
Protein-protein Interactions
Ren Y, et al. (2009) A structure-based mechanism for vesicle capture by the multisubunit tethering complex Dsl1. Cell 139(6):1119-29
       |DSL1 |EXO70 |SEC17 |SEC22 |SEC39 |TIP20 |UFE1 |USE1
Reviews
Saito C and Ueda T (2009) Chapter 4 Functions of RAB and SNARE Proteins in Plant Life. Int Rev Cell Mol Biol 274:183-233
       |MSO1 |PEP12 |PEP3 |PEP5 |PEP7 |SAR1 |SEC1 |SEC2 |SEC4 |SEC9 |SFT1 |SNC1 |SSO1 |USE1 |MORE
Reviews
Schmitt HD and Jahn R (2009) A tethering complex recruits SNAREs and grabs vesicles. Cell 139(6):1053-5
       |BET3 |BET5 |DSL1 |GSG1 |SEC1 |SEC23 |SEC39 |TIP20 |TRS20 |TRS23 |TRS31 |TRS33 |USE1
Mutants/Phenotypes
Strains/Constructs
Singh J and Tyers M (2009) A Rab escort protein integrates the secretion system with TOR signaling and ribosome biogenesis. Genes Dev 23(16):1944-58
       |AKR1 |AVL9 |DPM1 |ERG5 |ERV29 |GAB1 |GPI16 |MRS6 |MSB4 |MSN5 |PKC1 |ROT1 |SEC17 |SEC23 |MORE
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Tripathi A, et al. (2009) Structural characterization of Tip20p and Dsl1p, subunits of the Dsl1p vesicle tethering complex. Nat Struct Mol Biol 16(2):114-23
       |DSL1 |EXO70 |EXO84 |SEC15 |SEC39 |SEC6 |TIP20 |USE1
Mutants/Phenotypes
Strains/Constructs
Ungar L, et al. (2009) A genome-wide screen for essential yeast genes that affect telomere length maintenance. Nucleic Acids Res 37(12):3840-9
       |AAR2 |ALA1 |APC4 |ARC15 |ARC35 |ARP2 |ARP3 |BBP1 |CBF5 |CDC13 |CDC16 |CDC19 |CDC34 |CDC36 |MORE
Mutants/Phenotypes
Strains/Constructs
Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
       |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Genetic Interactions
Higashio H, et al. (2008) Smy2p Participates in COPII Vesicle Formation Through the Interaction with Sec23p/Sec24p Subcomplex. Traffic 9(1):79-93
         |BET1 |COG2 |COG3 |RET1 |RET3 |SAR1 |SEC12 |SEC13 |SEC16 |SEC17 |SEC18 |SEC21 |SEC22 |SEC23 |MORE
Evolution
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Koumandou VL, et al. (2007) Control systems for membrane fusion in the ancestral eukaryote; evolution of tethering complexes and SM proteins. BMC Evol Biol 7():29
           |BET3 |BET5 |COG1 |COG2 |COG3 |COG4 |COG5 |COG6 |COG7 |COG8 |DSL1 |EXO70 |EXO84 |GSG1 |MORE
Fungal Related Genes/Proteins
Kuratsu M, et al. (2007) Systematic analysis of SNARE localization in the filamentous fungus Aspergillus oryzae. Fungal Genet Biol 44(12):1310-23
       |BET1 |BOS1 |GOS1 |NYV1 |PEP12 |SEC22 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SPO20 |SSO1 |SSO2 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Altmann K and Westermann B (2005) Role of essential genes in mitochondrial morphogenesis in Saccharomyces cerevisiae. Mol Biol Cell 16(11):5410-7
           |ARC35 |ARC40 |ARP2 |BFR2 |CCT4 |CCT6 |CDC34 |CDC53 |COF1 |DSL1 |ERG1 |ERG10 |ERG12 |ERG13 |MORE
Reviews
Hong W (2005) SNAREs and traffic. Biochim Biophys Acta 1744(2):120-44
       |BET1 |BOS1 |GOS1 |NYV1 |PEP12 |SEC22 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SPO20 |SSO1 |SSO2 |MORE
Cellular Location
Protein-protein Interactions
Kraynack BA, et al. (2005) Dsl1p, Tip20p, and the novel Dsl3(Sec39) protein are required for the stability of the Q/t-SNARE complex at the endoplasmic reticulum in yeast. Mol Biol Cell 16(9):3963-77
       |DSL1 |SEC39 |TIP20 |UFE1 |USE1
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Li Y, et al. (2005) Structure-based functional analysis reveals a role for the SM protein Sly1p in retrograde transport to the endoplasmic reticulum. Mol Biol Cell 16(9):3951-62
       |BOS1 |DSL1 |SEC22 |SLY1 |TIP20 |UFE1 |USE1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Routt SM, et al. (2005) Nonclassical PITPs activate PLD via the Stt4p PtdIns-4-kinase and modulate function of late stages of exocytosis in vegetative yeast. Traffic 6(12):1157-72
           |CSR1 |LSB6 |MSS4 |PDR16 |PDR17 |PIK1 |PSD1 |SAC1 |SEC1 |SEC10 |SEC12 |SEC13 |SEC14 |SEC15 |MORE
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Protein Sequence Features
Reviews
Burri L and Lithgow T (2004) A complete set of SNAREs in yeast. Traffic 5(1):45-52
       |BET1 |BOS1 |FRT1 |FRT2 |GOS1 |NYV1 |PEP12 |SEC22 |SEC9 |SED5 |SFT1 |SNC1 |SNC2 |SSO1 |MORE
Non-Fungal Related Genes/Proteins
Nakajima K, et al. (2004) Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane fusion. EMBO J 23(16):3216-26

Function/Process
Protein Sequence Features
Protein-protein Interactions
Burri L, et al. (2003) A SNARE required for retrograde transport to the endoplasmic reticulum. Proc Natl Acad Sci U S A 100(17):9873-7
     |SEC22 |UFE1 |USE1 |YKT6
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Dilcher M, et al. (2003) Use1p is a yeast SNARE protein required for retrograde traffic to the ER. EMBO J 22(14):3664-74
     |BET1 |BOS1 |SEC22 |SED5 |UFE1 |USE1
Fungal Related Genes/Proteins
Weber Y, et al. (2002) Sec20p-interacting proteins (Tip20p, Ufe1p) in the retrograde secretory pathway of the fungal pathogen Candida albicans. Mol Genet Genomics 268(4):468-76
       |TIP20 |UFE1
Cellular Location
Function/Process
Genetic Interactions
Andag U, et al. (2001) The coatomer-interacting protein Dsl1p is required for Golgi-to-endoplasmic reticulum retrieval in yeast. J Biol Chem 276(42):39150-60
       |COP1 |DSL1 |ERD2 |KAR2 |SEC22 |TIP20
Cellular Location
Function/Process
Protein Physical Properties
Protein-protein Interactions
Reilly BA, et al. (2001) Golgi-to-endoplasmic reticulum (ER) retrograde traffic in yeast requires Dsl1p, a component of the ER target site that interacts with a COPI coat subunit. Mol Biol Cell 12(12):3783-96
       |DSL1 |KAR2 |RET2 |SLY1 |TIP20 |UFE1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Schleip I, et al. (2001) The yeast SEC20 gene is required for N- and O-glycosylation in the Golgi. Evidence that impaired glycosylation does not correlate with the secretory defect. J Biol Chem 276(31):28751-8

Fungal Related Genes/Proteins
Protein Sequence Features
Weber Y, et al. (2001) Divergence of eukaryotic secretory components: the Candida albicans homolog of the Saccharomyces cerevisiae ++Sec20 protein is N terminally truncated, and its levels determine antifungal drug resistance and growth. J Bacteriol 183(1):46-54
       |TIP20
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Finger FP and Novick P (2000) Synthetic interactions of the post-Golgi sec mutations of Saccharomyces cerevisiae. Genetics 156(3):943-51
       |ACT1 |CDC12 |CDC24 |CDC28 |CDC42 |DSS4 |GDI1 |MYO2 |SEC1 |SEC10 |SEC12 |SEC13 |SEC14 |SEC15 |MORE
Reviews
Pelham HR (1999) SNAREs and the secretory pathway-lessons from yeast. Exp Cell Res 247(1):1-8
       |GOS1 |NYV1 |SEC22 |SEC9 |SED5 |SNC1 |SNC2 |SPO20 |SSO1 |SSO2 |TLG1 |TLG2 |UFE1 |VAM3 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Substrates/Ligands/Cofactors
Ballensiefen W, et al. (1998) Recycling of the yeast v-SNARE Sec22p involves COPI-proteins and the ER transmembrane proteins Ufe1p and Sec20p. J Cell Sci 111 ( Pt 11):1507-20
       |SEC21 |SEC22 |SEC27 |UFE1
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Frigerio G (1998) The Saccharomyces cerevisiae early secretion mutant tip20 is synthetic lethal with mutants in yeast coatomer and the SNARE proteins Sec22p and Ufe1p. Yeast 14(7):633-46
       |RET2 |SEC21 |SEC22 |SEC27 |TIP20 |UFE1
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Patel SK, et al. (1998) Organelle membrane fusion: a novel function for the syntaxin homolog Ufe1p in ER membrane fusion. Cell 92(5):611-20
       |CDC48 |TIP20 |UFE1
Function/Process
Protein-protein Interactions
Cosson P, et al. (1997) The Sec20/Tip20p complex is involved in ER retrieval of dilysine-tagged proteins. Eur J Cell Biol 73(2):93-7
     |EMP47 |TIP20
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Lewis MJ, et al. (1997) A novel SNARE complex implicated in vesicle fusion with the endoplasmic reticulum. EMBO J 16(11):3017-24
       |SEC22 |TIP20 |UFE1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Shimma Y, et al. (1997) A defect in GTP synthesis affects mannose outer chain elongation in Saccharomyces cerevisiae. Mol Gen Genet 256(5):469-80
     |ALG1 |GUK1 |PSA1
Protein-protein Interactions
Voet M, et al. (1997) The sequence of a nearly unclonable 22.8 kb segment on the left arm chromosome VII from Saccharomyces cerevisiae reveals ARO2, RPL9A, TIP1, MRF1 genes and six new open reading frames. Yeast 13(2):177-82
       |ARO2 |FLC3 |GPI10 |HUL5 |MRF1 |ROG1 |RPL9A |RRT6 |TIP20 |YGL140C
Mutants/Phenotypes
Regulatory Role
Lewis MJ and Pelham HR (1996) SNARE-mediated retrograde traffic from the Golgi complex to the endoplasmic reticulum. Cell 85(2):205-15
       |ERD2 |SEC21 |UFE1
Function/Process
Genetic Interactions
Protein-protein Interactions
Regulatory Role
Sweet DJ and Pelham HR (1993) The TIP1 gene of Saccharomyces cerevisiae encodes an 80 kDa cytoplasmic protein that interacts with the cytoplasmic domain of Sec20p. EMBO J 12(7):2831-40
     |TIP20
Reviews
Pryer NK, et al. (1992) Vesicle-mediated protein sorting. Annu Rev Biochem 61:471-516
     |ARF1 |ARF2 |BET1 |BET2 |BOS1 |CHC1 |CLC1 |ERD1 |ERD2 |SAR1 |SEC1 |SEC12 |SEC13 |SEC14 |MORE
Cellular Location
DNA/RNA Sequence Features
Function/Process
Protein Processing/Modification/Regulation
Protein Sequence Features
Regulatory Role
Strains/Constructs
Sweet DJ and Pelham HR (1992) The Saccharomyces cerevisiae SEC20 gene encodes a membrane glycoprotein which is sorted by the HDEL retrieval system. EMBO J 11(2):423-32

Function/Process
Mutants/Phenotypes
Puoti A, et al. (1991) Biosynthesis of mannosylinositolphosphoceramide in Saccharomyces cerevisiae is dependent on genes controlling the flow of secretory vesicles from the endoplasmic reticulum to the Golgi. J Cell Biol 113(3):515-25
       |SEC12 |SEC13 |SEC14 |SEC16 |SEC17 |SEC18 |SEC21 |SEC22 |SEC23 |SEC6 |SEC7
Reviews
Newman AP and Ferro-Novick S (1990) Defining components required for transport from the ER to the Golgi complex in yeast. Bioessays 12(10):485-91
     |ARF1 |ARF2 |BET1 |BET2 |BOS1 |SAR1 |SEC12 |SEC13 |SEC16 |SEC17 |SEC18 |SEC21 |SEC22 |SEC23 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Ramirez RM, et al. (1983) Plasma membrane expansion terminates in Saccharomyces cerevisiae secretion-defective mutants while phospholipid synthesis continues. J Bacteriol 154(3):1276-83
     |GDI1 |SEC1 |SEC10 |SEC11 |SEC12 |SEC13 |SEC14 |SEC15 |SEC16 |SEC17 |SEC18 |SEC2 |SEC21 |SEC22 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Novick P, et al. (1981) Order of events in the yeast secretory pathway. Cell 25(2):461-9
       |GDI1 |SEC1 |SEC12 |SEC14 |SEC15 |SEC16 |SEC18 |SEC2 |SEC21 |SEC22 |SEC23 |SEC3 |SEC4 |SEC5 |MORE
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Novick P, et al. (1980) Identification of 23 complementation groups required for post-translational events in the yeast secretory pathway. Cell 21(1):205-15
       |GDI1 |SEC1 |SEC10 |SEC11 |SEC12 |SEC13 |SEC14 |SEC15 |SEC16 |SEC17 |SEC18 |SEC2 |SEC21 |SEC22 |MORE

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.