GPI17/YDR434W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrIV: 1331230 to 1332834
CDS: 1331230 - 1332834

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

GPI17 YDR434W ORF, Verified S000002842

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2001-06-18. Gene name expires on 2002-06-18.
Description
Transmembrane protein subunit of the glycosylphosphatidylinositol transamidase complex that adds GPIs to newly synthesized proteins; human PIG-Sp homolog

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
GPI-anchor transamidase activity Ohishi K, et al. (2001) PIG-S and PIG-T, essential for GPI anchor attachment to proteins, form a complex with GAA1 and GPI8. EMBO J 20(15):4088-98
       ISS : Inferred from Sequence or structural Similarity
IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-03 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
GPI anchor biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0337
Assigned on 2007-05-23 UniProtKB
attachment of GPI anchor to protein Ohishi K, et al. (2001) PIG-S and PIG-T, essential for GPI anchor attachment to proteins, form a complex with GAA1 and GPI8. EMBO J 20(15):4088-98
       ISS : Inferred from Sequence or structural Similarity
IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-03 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
colocalizes_with GPI-anchor transamidase complex Zhu Y, et al. (2005) Gpi17p does not stably interact with other subunits of glycosylphosphatidylinositol transamidase in Saccharomyces cerevisiae. Biochim Biophys Acta 1735(1):79-88
       IDA : Inferred from Direct Assay
Assigned on 2009-07-01 SGD
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane Zhu Y, et al. (2005) Gpi17p does not stably interact with other subunits of glycosylphosphatidylinositol transamidase in Saccharomyces cerevisiae. Biochim Biophys Acta 1735(1):79-88
       IDA : Inferred from Direct Assay
Assigned on 2009-07-01 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forGPI17/YDR434W for GPI17
1) Ohishi K, et al. (2001) PIG-S and PIG-T, essential for GPI anchor attachment to proteins, form a complex with GAA1 and GPI8. EMBO J 20(15):4088-98

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for GPI17/YDR434W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for GPI17/YDR434W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSNANLR

C-term IDGEDEL

Length(aa) 534

MW(Da) 60,814

pI 4.53

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.013

Codon Adaptation Index 0.144

Frequency of Optimal Codons 0.419

Hydropathicity of Protein -0.093

Aromaticity Score 0.112

10 20 30 40 50 | | | | | MSNANLRKWVGFCFVAIYLFLGVPLWYKLTTVYRASLPINYIESLQNNKF QDIHLVIPVYVKSDTYRFPDVHDAIQVQVNHLLNSQEQRVPWSLQVLPYN ETIEQMESEGNQFHVVTLKLDEFIGYSSAYDTKETLVYYDDAAVLSNDLP FFVAQTLVEHTFQLEWTHLNKTCEGVSTNNDVAISYDPNIHLSVTLLSGD GNPVAWEIEPTLTDYFSPFRKFLSPLVNFTVDSSIVYHNDLNLHSLNGSC TSVTWFDLSHTIDLSELSSMAYYPEDSALNLAIVFPSASSSPDGLAFING TRISDEITTLDWNSYLVPQWGVIIINKMPLKPNSVISEDYLEPMMYRFAT DIFQLLGLTEGSQDLLSPYITIDSFKRLTILQNLDKATETLWSLVKLTQQ FQGMSIPREVSDNVIEALDLRLQIIDLLNDPGKGGDIVWNNALHLSNELV KLCEKAFFNGEMVQQNFFPQEHMIAVYLPLLGPISAVMFFGFYNVMKEKN QKSKKNGTEREVAKEKLELKEAQKLHAIDGEDEL*

Protein Structures from PDB: proteins of known structure with sequence similarity to GPI17/YDR434W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
GPI17 2001-07-25 Ohishi K, et al. (2001) PIG-S and PIG-T, essential for GPI anchor attachment to proteins, form a complex with GAA1 and GPI8. EMBO J 20(15):4088-98

Standard Name	Date Standardized	Reference
GPI17	2001-07-25	*Ohishi K, et al.* (2001)** PIG-S and PIG-T, essential for GPI anchor attachment to proteins, form a complex with GAA1 and GPI8. EMBO J 20(15):4088-98

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YDR434W SGD Systematic Sequence

852044 NCBI: Gene ID

NP_010722.1 NCBI: RefSeq protein version ID

NP_010722.1 NCBI: RefSeq protein version ID

6320642 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YDR434W	SGD Systematic Sequence
852044	NCBI: Gene ID
NP_010722.1	NCBI: RefSeq protein version ID
NP_010722.1	NCBI: RefSeq protein version ID
6320642	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
14 curated references; 0 references not yet curated
Reviews
Fujita M and Kinoshita T (2009) Structural remodeling of GPI anchors during biosynthesis and after attachment to proteins. FEBS Lett
     |ARV1 |BST1 |CDC1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |MORE
Mutants/Phenotypes
Protein Processing/Modification/Regulation
RNA Levels and Processing
Regulation of
Strains/Constructs
Transcription
Ghazal G, et al. (2009) Yeast RNase III triggers polyadenylation-independent transcription termination. Mol Cell 36(1):99-109
       |CDC19 |CSR1 |FTR1 |GIC2 |KEM1 |LGE1 |LYP1 |MED7 |MIC17 |MRH1 |NAB2 |NAM7 |NCB2 |NOP1 |MORE
RNA Levels and Processing
Rondon AG, et al. (2009) Fail-safe transcriptional termination for protein-coding genes in S. cerevisiae. Mol Cell 36(1):88-98
       |NAB3 |NPL3 |NRD1 |PAP1 |RAT1 |RNT1 |SEN1
Mutants/Phenotypes
Strains/Constructs
Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
       |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Reviews
Bosson R and Conzelmann A (2007) Multiple functions of inositolphosphorylceramides in the formation and intracellular transport of glycosylphosphatidylinositol-anchored proteins in yeast. Biochem Soc Symp (74):199-209
     |BST1 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI18 |GPI19 |MORE
Reviews
Orlean P and Menon AK (2007) Thematic review series: lipid posttranslational modifications. GPI anchoring of protein in yeast and mammalian cells, or: how we learned to stop worrying and love glycophospholipids. J Lipid Res 48(5):993-1011
         |BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI18 |MORE
Reviews
Pittet M and Conzelmann A (2007) Biosynthesis and function of GPI proteins in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):405-20
       |BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI18 |MORE
Protein Physical Properties
White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36
         |ALG1 |ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |MORE
Regulation of
Transcription
Fry RC, et al. (2006) The DNA-damage signature in Saccharomyces cerevisiae is associated with single-strand breaks in DNA. BMC Genomics 7():313
         |AAH1 |AHP1 |ALG14 |AMN1 |ASF1 |BAT1 |BUD4 |CAC2 |CAR1 |CDC42 |CDC8 |CHA1 |CHS2 |CIC1 |MORE
Protein-protein Interactions
Hardwidge PR, et al. (2006) Proteomic analysis of the binding partners to enteropathogenic Escherichia coli virulence proteins expressed in Saccharomyces cerevisiae. Proteomics 6(7):2174-9
       |ACT1 |ADE6 |AHP1 |APP1 |ARD1 |BCK1 |BOI1 |BUD2 |BUD8 |CHS3 |CRH1 |CSN12 |ELM1 |ENO1 |MORE
Function/Process
Genetic Interactions
Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19
           |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Cellular Location
Fungal Related Genes/Proteins
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Protein Processing/Modification/Regulation
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Techniques and Reagents
Zhu Y, et al. (2005) Gpi17p does not stably interact with other subunits of glycosylphosphatidylinositol transamidase in Saccharomyces cerevisiae. Biochim Biophys Acta 1735(1):79-88
       |GAA1 |GPI16 |GPI8
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Grimme SJ, et al. (2004) Deficiencies in the endoplasmic reticulum (ER)-membrane protein Gab1p perturb transfer of glycosylphosphatidylinositol to proteins and cause perinuclear ER-associated actin bar formation. Mol Biol Cell 15(6):2758-70
       |ACT1 |GAA1 |GAB1 |GPI16 |GPI8
Function/Process
Non-Fungal Related Genes/Proteins
Ohishi K, et al. (2001) PIG-S and PIG-T, essential for GPI anchor attachment to proteins, form a complex with GAA1 and GPI8. EMBO J 20(15):4088-98
       |GAA1 |GPI16 |GPI8

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.