---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

PDR15/YDR406W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIV: 1279203 to 1283792 CDS: 1279203 - 1283792 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
PDR15	YDR406W		ORF, Verified	S000002814
Description
Plasma membrane ATP binding cassette (ABC) transporter, multidrug transporter and general stress response factor implicated in cellular detoxification; regulated by Pdr1p, Pdr3p and Pdr8p; promoter contains a PDR responsive element

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By ATP binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003439 , EBI:IPR017871 , EBI:IPR010929 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0067 Assigned on 2007-05-23 UniProtKB ATPase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003439 , EBI:IPR017871 Assigned on 2007-05-23 UniProtKB ATPase activity, coupled to transmembrane movement of substances Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC proteins. Nat Genet 15(2):137-45      ISS : Inferred from Sequence or structural Similarity Assigned on 2002-07-11 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR010929 Assigned on 2007-05-23 UniProtKB nucleoside-triphosphatase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003593 Assigned on 2007-05-23 UniProtKB nucleotide binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003593 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0547 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By cellular response to heat Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439        RCA : Reviewed Computational Analysis Assigned on 2009-03-03 SGD response to drug Schuller C, et al. (2007) Membrane-active Compounds Activate the Transcription Factors Pdr1 and Pdr3 Connecting Pleiotropic Drug Resistance and Membrane Lipid Homeostasis in Saccharomyces cerevisiae. Mol Biol Cell 18(12):4932-44        IMP : Inferred from Mutant Phenotype Assigned on 2007-10-12 SGD transport Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC proteins. Nat Genet 15(2):137-45      ISS : Inferred from Sequence or structural Similarity Assigned on 2002-07-11 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR010929 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By integral to membrane Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC proteins. Nat Genet 15(2):137-45      ISS : Inferred from Sequence or structural Similarity Assigned on 2002-07-11 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR010929 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR013525 Assigned on 2009-06-17 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forPDR15/YDR406W for PDR15 1) Decottignies A, et al. (1998) ATPase and multidrug transport activities of the overexpressed yeast ABC protein Yor1p. J Biol Chem 273(20):12612-22        2) Wolfger H, et al. (1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15 are novel targets for the Pdr1 and Pdr3 transcriptional regulators. FEBS Lett 418(3):269-74        3) Hikkel I, et al. (2003) A general strategy to uncover transcription factor properties identifies a new regulator of drug resistance in yeast. J Biol Chem 278(13):11427-32        4) Wolfger H, et al. (2004) The yeast Pdr15p ATP-binding cassette (ABC) protein is a general stress response factor implicated in cellular detoxification. J Biol Chem 279(12):11593-9

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PDR15/YDR406W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PDR15/YDR406W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSSDIRD C-term ISEKPKK Length(aa) 1,529 MW(Da) 172,254 pI 7.87 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.174   Codon Adaptation Index 0.183   Frequency of Optimal Codons 0.505   Hydropathicity of Protein -0.171   Aromaticity Score 0.124

10 20 30 40 50 | | | | | MSSDIRDVEERNSRSSSSSSSSNSAAQSIGQHPYRGFDSEAAERVHELAR TLTSQSLLYTANSNNSSSSNHNAHNADSRSVFSTDMEGVNPVFTNPDTPG YNPKLDPNSDQFSSTAWVQNMANICTSDPDFYKPYSLGCVWKNLSASGDS ADVSYQSTFANIVPKLLTKGLRLLKPSKEEDTFQILKPMDGCLNPGELLV VLGRPGSGCTTLLKSISSNSHGFKIAKDSIVSYNGLSSSDIRKHYRGEVV YNAESDIHLPHLTVYQTLFTVARMKTPQNRIKGVDREAYANHVTEVAMAT YGLSHTRDTKVGNDLVRGVSGGERKRVSIAEVAICGARFQCWDNATRGLD SATALEFIRALKTQADIGKTAATVAIYQCSQDAYDLFDKVCVLDDGYQLY FGPAKDAKKYFQDMGYYCPPRQTTADFLTSITSPTERIISKEFIEKGTRV PQTPKDMAEYWLQSESYKNLIKDIDSTLEKNTDEARNIIRDAHHAKQAKR APPSSPYVVNYGMQVKYLLIRNFWRMKQSASVTLWQVIGNSVMAFILGSM FYKVMKKNDTSTFYFRGAAMFFAILFNAFSCLLEIFSLYETRPITEKHRT YSLYHPSADAFASVLSEMPPKLITAVCFNIIFYFLVDFRRNGGVFFFYFL INVIATFTLSHLFRCVGSLTKTLQEAMVPASMLLLAISMYTGFAIPKTKI LGWSIWIWYINPLAYLFESLMINEFHDRRFPCAQYIPAGPAYQNITGTQR VCSAVGAYPGNDYVLGDDFLKESYDYEHKHKWRGFGIGMAYVVFFFFVYL ILCEYNEGAKQKGEMVVFLRSKIKQLKKEGKLQEKHRPGDIENNAGSSPD SATTEKKILDDSSEGSDSSSDNAGLGLSKSEAIFHWRDLCYDVPIKGGQR RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDG RLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEKNRY VEEVIKILEMQQYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLD EPTSGLDSQTAWDTCQLMRKLATHGQAILCTIHQPSAILMQQFDRLLFLQ KGGQTVYFGDLGEGCKTMIDYFESKGAHKCPPDANPAEWMLEVVGAAPGS HATQDYNEVWRNSDEYKAVQEELDWMEKNLPGRSKEPTAEEHKPFAASLY YQFKMVTIRLFQQYWRSPDYLWSKFILTIFNQVFIGFTFFKADRSLQGLQ NQMLSIFMYTVIFNPILQQYLPSFVQQRDLYEARERPSRTFSWLAFFLSQ IIVEIPWNILAGTIAYCIYYYAVGFYANASAAGQLHERGALFWLFSIAFY VYIGSMGLLMISFNEVAETAAHMGTLLFTMALSFCGVMATPKVMPRFWIF MYRVSPLTYMIDALLALGVANVDVKCSNYEMVKFTPPSGTTCGDYMASYI KLAGTGYLSDPSATDICSFCAVSTTNAFLATFSSHYYRRWRNYGIFICYI AFDYIAATFLYWLSRVPKKNGKISEKPKK*

Protein Structures from PDB: proteins of known structure with sequence similarity to PDR15/YDR406W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to PDR15 Homolog Source (per PDB) Protein Alignment: PDR15 vs. Homolog External Links P-Value %Identical %Similar Alignment 3g5u ( Chain: A, B) Structure of p-glycoprotein reveals a molecular basis for poly-specific drug binding PDB_Info PDB_Structure Mus musculus Chain A = 2.7e-11 22 28 View alignment SCOP MMDB CATH Chain B = 2.7e-11 22 28 View alignment 3g60 ( Chain: B, A) Structure of p-glycoprotein reveals a molecular basis for poly-specific drug binding PDB_Info PDB_Structure Mus musculus Chain B = 3.9e-11 22 28 View alignment SCOP MMDB CATH Chain A = 3.9e-11 22 28 View alignment 3g61 ( Chain: A, B) Structure of p-glycoprotein reveals a molecular basis for poly-specific drug binding PDB_Info PDB_Structure Mus musculus Chain A = 3.9e-11 22 28 View alignment SCOP MMDB CATH Chain B = 3.9e-11 22 28 View alignment 1mt0 ( Chain: A) Atp-binding domain of haemolysin b from escherichia coli PDB_Info PDB_Structure Escherichia coli 2.1e-09 29 33 View alignment SCOP MMDB CATH 2pmk ( Chain: A) Crystal structures of an isolated abc-atpase in complex with tnp-adp PDB_Info PDB_Structure Escherichia coli 2.1e-09 29 33 View alignment SCOP MMDB CATH 2ff7 ( Chain: A) The abc-atpase of the abc-transporter hlyb in the adp bound state PDB_Info PDB_Structure Escherichia coli 2.3e-09 29 33 View alignment SCOP MMDB CATH 1f3o ( Chain: A) Crystal structure of mj0796 atp-binding cassette PDB_Info PDB_Structure Methanocaldococcus jannaschii 2.8e-09 27 35 View alignment SCOP MMDB CATH 3b5j ( Chain: A) Crystal structures of the s504a mutant of an isolated abc- atpase in complex with tnp-adp PDB_Info PDB_Structure Escherichia coli 4.2e-09 28 34 View alignment SCOP MMDB CATH 2fgk ( Chain: D, B, A, C) Crystal structure of the abc-cassette e631q mutant of hlyb with bound atp PDB_Info PDB_Structure Escherichia coli Chain D = 4.3e-09 28 34 View alignment SCOP MMDB CATH Chain B = 4.3e-09 28 34 View alignment Chain A = 4.3e-09 28 34 View alignment Chain C = 4.3e-09 28 34 View alignment 2ffb ( Chain: A) The crystal structure of the hlyb-nbd e631q mutant in complex with adp PDB_Info PDB_Structure Escherichia coli 4.3e-09 28 34 View alignment SCOP MMDB CATH 1l2t ( Chain: A, B) Dimeric structure of mj0796, a bacterial abc transporter cassette PDB_Info PDB_Structure Methanocaldococcus jannaschii Chain A = 5.8e-09 27 35 View alignment SCOP MMDB CATH Chain B = 5.8e-09 27 35 View alignment 1xef ( Chain: D, C, B, A) Crystal structure of the atp/mg2+ bound composite dimer of hlyb-nbd PDB_Info PDB_Structure Escherichia coli Chain D = 1.5e-08 28 34 View alignment SCOP MMDB CATH Chain C = 1.5e-08 28 34 View alignment Chain B = 1.5e-08 28 34 View alignment Chain A = 1.5e-08 28 34 View alignment 2fgj ( Chain: B, A, C, D) Crystal structure of the abc-cassette h662a mutant of hlyb with bound atp PDB_Info PDB_Structure Escherichia coli Chain B = 1.7e-08 28 34 View alignment SCOP MMDB CATH Chain A = 1.7e-08 28 34 View alignment Chain C = 1.7e-08 28 34 View alignment Chain D = 1.7e-08 28 34 View alignment 2ffa ( Chain: A) Crystal structure of abc-atpase h662a of the abc- transporter hlyb in complex with adp PDB_Info PDB_Structure Escherichia coli 1.7e-08 28 34 View alignment SCOP MMDB CATH 1z47 ( Chain: A, B) Structure of the atpase subunit cysa of the putative sulfate atp-binding cassette (abc) transporter from alicyclobacillus acidocaldarius PDB_Info PDB_Structure Alicyclobacillus acidocaldarius Chain A = 2.5e-08 27 34 View alignment SCOP MMDB CATH Chain B = 2.5e-08 27 34 View alignment 3c41 ( Chain: K, J) Abc protein artp in complex with amp-pnp/mg2+ PDB_Info PDB_Structure Geobacillus stearothermophilus Chain K = 3.2e-08 24 38 View alignment SCOP MMDB CATH Chain J = 3.2e-08 24 38 View alignment 2ouk ( Chain: C, D, A, B) Abc protein artp in complex with sulphate PDB_Info PDB_Structure Geobacillus stearothermophilus Chain C = 3.7e-08 24 38 View alignment SCOP MMDB CATH Chain D = 3.7e-08 24 38 View alignment Chain A = 3.7e-08 24 38 View alignment Chain B = 3.7e-08 24 38 View alignment 2olk ( Chain: A, C, D, B) Abc protein artp in complex with adp-beta-s PDB_Info PDB_Structure Geobacillus stearothermophilus Chain A = 3.7e-08 24 38 View alignment SCOP MMDB CATH Chain C = 3.7e-08 24 38 View alignment Chain D = 3.7e-08 24 38 View alignment Chain B = 3.7e-08 24 38 View alignment 3c4j ( Chain: A, B) Abc protein artp in complex with atp-gamma-s PDB_Info PDB_Structure Geobacillus stearothermophilus Chain A = 3.7e-08 24 38 View alignment SCOP MMDB CATH Chain B = 3.7e-08 24 38 View alignment 2olj ( Chain: B, A) Abc protein artp in complex with adp/mg2+ PDB_Info PDB_Structure Geobacillus stearothermophilus Chain B = 3.7e-08 24 38 View alignment SCOP MMDB CATH Chain A = 3.7e-08 24 38 View alignment 2q0h ( Chain: A, B) Abc protein artp in complex with adp/mg2+, atp-gamma-s hydrolyzed PDB_Info PDB_Structure Geobacillus stearothermophilus Chain A = 3.7e-08 24 38 View alignment SCOP MMDB CATH Chain B = 3.7e-08 24 38 View alignment 1vpl ( Chain: A) Crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution PDB_Info PDB_Structure Thermotoga maritima MSB8 5.8e-08 27 33 View alignment SCOP MMDB CATH 2it1 ( Chain: A, B) Structure of ph0203 protein from pyrococcus horikoshii PDB_Info PDB_Structure Pyrococcus horikoshii Chain A = 9.9e-08 29 27 View alignment SCOP MMDB CATH Chain B = 9.9e-08 29 27 View alignment 3b5x ( Chain: A, B) Crystal structure of msba from vibrio cholerae PDB_Info PDB_Structure Vibrio cholerae Chain A = 1.9e-07 29 31 View alignment SCOP MMDB CATH Chain B = 1.9e-07 29 31 View alignment 3fvq ( Chain: B, A) Fe(3+) ions import ATP- PDB_Info PDB_Structure Unknown Chain B = 2.6e-07 28 31 View alignment SCOP MMDB CATH Chain A = 2.6e-07 28 31 View alignment 3b5y ( Chain: B, C, D, A) Crystal structure of msba from salmonella typhimurium with amppnp PDB_Info PDB_Structure Salmonella typhimurium Chain B = 2.9e-07 26 35 View alignment SCOP MMDB CATH Chain C = 2.9e-07 26 35 View alignment Chain D = 2.9e-07 26 35 View alignment Chain A = 2.9e-07 26 35 View alignment 3b60 ( Chain: C, A, B, D) Crystal structure of msba from salmonella typhimurium with amppnp, higher resolution form PDB_Info PDB_Structure Salmonella typhimurium Chain C = 2.9e-07 26 35 View alignment SCOP MMDB CATH Chain A = 2.9e-07 26 35 View alignment Chain B = 2.9e-07 26 35 View alignment Chain D = 2.9e-07 26 35 View alignment 3b5z ( Chain: D, B, C, A) Crystal structure of msba from salmonella typhimurium with adp vanadate PDB_Info PDB_Structure Salmonella typhimurium Chain D = 2.9e-07 26 35 View alignment SCOP MMDB CATH Chain B = 2.9e-07 26 35 View alignment Chain C = 2.9e-07 26 35 View alignment Chain A = 2.9e-07 26 35 View alignment 1mv5 ( Chain: A, D, C, B) Crystal structure of lmra atp-binding domain PDB_Info PDB_Structure Lactococcus lactis Chain A = 4.8e-07 27 35 View alignment SCOP MMDB CATH Chain D = 4.8e-07 27 35 View alignment Chain C = 4.8e-07 27 35 View alignment Chain B = 4.8e-07 27 35 View alignment 1b0u ( Chain: A) Atp-binding subunit of the histidine permease from salmonella typhimurium PDB_Info PDB_Structure Salmonella typhimurium 6.3e-07 25 35 View alignment SCOP MMDB CATH 3b5w ( Chain: B, E, C, G, A, H, D, F) Crystal structure of eschericia coli msba PDB_Info PDB_Structure Escherichia coli Chain B = 6.6e-07 27 33 View alignment SCOP MMDB CATH Chain E = 6.6e-07 27 33 View alignment Chain C = 6.6e-07 27 33 View alignment Chain G = 6.6e-07 27 33 View alignment Chain A = 6.6e-07 27 33 View alignment Chain H = 6.6e-07 27 33 View alignment Chain D = 6.6e-07 27 33 View alignment Chain F = 6.6e-07 27 33 View alignment 2hyd ( Chain: A, B) Multidrug abc transporter sav1866 PDB_Info PDB_Structure Staphylococcus aureus Chain A = 9.1e-07 29 33 View alignment SCOP MMDB CATH Chain B = 9.1e-07 29 33 View alignment 2onj ( Chain: A, B) Structure of the multidrug abc transporter sav1866 from s. aureus in complex with amp-pnp PDB_Info PDB_Structure Staphylococcus aureus Chain A = 9.1e-07 29 33 View alignment SCOP MMDB CATH Chain B = 9.1e-07 29 33 View alignment 1oxx ( Chain: K) Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus PDB_Info PDB_Structure Sulfolobus solfataricus 1.2e-06 30 27 View alignment SCOP MMDB CATH 1oxs ( Chain: C) Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus PDB_Info PDB_Structure Sulfolobus solfataricus 1.6e-06 30 27 View alignment SCOP MMDB CATH 1oxt ( Chain: A, B, D) Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus PDB_Info PDB_Structure Sulfolobus solfataricus Chain A = 1.6e-06 30 27 View alignment SCOP MMDB CATH Chain B = 1.6e-06 30 27 View alignment Chain D = 1.6e-06 30 27 View alignment 1oxu ( Chain: B, C, A) Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus PDB_Info PDB_Structure Sulfolobus solfataricus Chain B = 1.6e-06 30 27 View alignment SCOP MMDB CATH Chain C = 1.6e-06 30 27 View alignment Chain A = 1.6e-06 30 27 View alignment 1oxv ( Chain: B, A, D) Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus PDB_Info PDB_Structure Sulfolobus solfataricus Chain B = 1.6e-06 30 27 View alignment SCOP MMDB CATH Chain A = 1.6e-06 30 27 View alignment Chain D = 1.6e-06 30 27 View alignment 2yz2 ( Chain: B, A) Crystal structure of the abc transporter in the cobalt transport system PDB_Info PDB_Structure Thermotoga maritima MSB8 Chain B = 1.7e-06 24 34 View alignment SCOP MMDB CATH Chain A = 1.7e-06 24 34 View alignment 3dhw ( Chain: D, H, G, C) Crystal structure of methionine importer metni PDB_Info PDB_Structure Escherichia coli k12 Chain D = 1.8e-06 31 28 View alignment SCOP MMDB CATH Chain H = 1.8e-06 31 28 View alignment Chain G = 1.8e-06 31 28 View alignment Chain C = 1.8e-06 31 28 View alignment 3gfo ( Chain: A) Structure of cbio1 from clostridium perfringens: part of the abc transporter complex cbionq. PDB_Info PDB_Structure Clostridium perfringens ATCC 13124 1.8e-06 26 35 View alignment SCOP MMDB CATH 2awn ( Chain: B, A, C, D) Crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) PDB_Info PDB_Structure Escherichia coli k12 Chain B = 2.5e-06 26 34 View alignment SCOP MMDB CATH Chain A = 2.5e-06 26 34 View alignment Chain C = 2.5e-06 26 34 View alignment Chain D = 2.5e-06 26 34 View alignment 1q1b ( Chain: D, A, C, B) Crystal structure of e. coli malk in the nucleotide-free form PDB_Info PDB_Structure Escherichia coli k12 Chain D = 2.5e-06 26 34 View alignment SCOP MMDB CATH Chain A = 2.5e-06 26 34 View alignment Chain C = 2.5e-06 26 34 View alignment Chain B = 2.5e-06 26 34 View alignment 1q12 ( Chain: A, D, B, C) Crystal structure of the atp-bound e. coli malk PDB_Info PDB_Structure Escherichia coli k12 Chain A = 2.5e-06 26 34 View alignment SCOP MMDB CATH Chain D = 2.5e-06 26 34 View alignment Chain B = 2.5e-06 26 34 View alignment Chain C = 2.5e-06 26 34 View alignment 2awo ( Chain: C, D, A, B) Crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) PDB_Info PDB_Structure Escherichia coli k12 Chain C = 2.5e-06 26 34 View alignment SCOP MMDB CATH Chain D = 2.5e-06 26 34 View alignment Chain A = 2.5e-06 26 34 View alignment Chain B = 2.5e-06 26 34 View alignment 3fh6 ( Chain: B, D, C, A) Crystal structure of the resting state maltose transporter from e. coli PDB_Info PDB_Structure Escherichia coli K-12 Chain B = 2.5e-06 26 34 View alignment SCOP MMDB CATH Chain D = 2.5e-06 26 34 View alignment Chain C = 2.5e-06 26 34 View alignment Chain A = 2.5e-06 26 34 View alignment 1q1e ( Chain: A, B) The atpase component of e. coli maltose transporter (malk) in the nucleotide-free form PDB_Info PDB_Structure Escherichia coli k12 Chain A = 2.5e-06 26 34 View alignment SCOP MMDB CATH Chain B = 2.5e-06 26 34 View alignment 2ghi ( Chain: C, B, A, D) Crystal structure of plasmodium yoelii multidrug resistance protein 2 PDB_Info PDB_Structure Plasmodium yoelii yoelii str. 17XNL Chain C = 3.3e-06 26 30 View alignment SCOP MMDB CATH Chain B = 3.3e-06 26 30 View alignment Chain A = 3.3e-06 26 30 View alignment Chain D = 3.3e-06 26 30 View alignment 2yyz ( Chain: A) Crystal structure of sugar abc transporter, atp-binding protein PDB_Info PDB_Structure Thermotoga maritima MSB8 4.6e-06 28 26 View alignment SCOP MMDB CATH 2r6g ( Chain: B, A) The crystal structure of the e. coli maltose transporter PDB_Info PDB_Structure Escherichia coli k12 Chain B = 5.1e-06 25 35 View alignment SCOP MMDB CATH Chain A = 5.1e-06 25 35 View alignment 1jj7 ( Chain: A) Crystal structure of the c-terminal atpase domain of human tap1 PDB_Info PDB_Structure Homo sapiens 1.2e-05 26 31 View alignment SCOP MMDB CATH 1g6h ( Chain: A) Crystal structure of the adp conformation of mj1267, an atp- binding cassette of an abc transporter PDB_Info PDB_Structure Methanocaldococcus jannaschii 1.2e-05 27 30 View alignment SCOP MMDB CATH 1g9x ( Chain: C, A, B) Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter PDB_Info PDB_Structure Methanocaldococcus jannaschii Chain C = 3.0e-05 27 29 View alignment SCOP MMDB CATH Chain A = 3.0e-05 27 29 View alignment Chain B = 3.0e-05 27 29 View alignment 1gaj ( Chain: A) Crystal structure of a nucleotide-free atp-binding cassette from an abc transporter PDB_Info PDB_Structure Methanocaldococcus jannaschii 3.5e-05 27 30 View alignment SCOP MMDB CATH 2d62 ( Chain: A) Crystal structure of multiple sugar binding transport atp- binding protein PDB_Info PDB_Structure Pyrococcus horikoshii 4.4e-05 28 26 View alignment SCOP MMDB CATH 2ixf ( Chain: D, C, A, B) Crystal structure of the atpase domain of tap1 with atp (d645q, q678h mutant) PDB_Info PDB_Structure Rattus norvegicus Chain D = 5.3e-05 24 34 View alignment SCOP MMDB CATH Chain C = 5.3e-05 24 34 View alignment Chain A = 5.3e-05 24 34 View alignment Chain B = 5.3e-05 24 34 View alignment 1vci ( Chain: A) Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp PDB_Info PDB_Structure Pyrococcus horikoshii 7.4e-05 26 30 View alignment SCOP MMDB CATH 1v43 ( Chain: A) Crystal structure of atpase subunit of abc sugar transporter PDB_Info PDB_Structure Pyrococcus horikoshii 7.4e-05 26 30 View alignment SCOP MMDB CATH 2ixg ( Chain: A) Crystal structure of the atpase domain of tap1 with atp (s621a, g622v, d645n mutant) PDB_Info PDB_Structure Rattus norvegicus 0.000110 24 34 View alignment SCOP MMDB CATH 2pze ( Chain: B, A) Minimal human cftr first nucleotide binding domain as a head-to-tail dimer PDB_Info PDB_Structure Homo sapiens Chain B = 0.000190 24 33 View alignment SCOP MMDB CATH Chain A = 0.000190 24 33 View alignment 2pzg ( Chain: B, A) Minimal human cftr first nucleotide binding domain as a monomer PDB_Info PDB_Structure Homo sapiens Chain B = 0.000210 24 33 View alignment SCOP MMDB CATH Chain A = 0.000210 24 33 View alignment 1g29 ( Chain: 2, 1) Malk PDB_Info PDB_Structure Thermococcus litoralis Chain 2 = 0.000239 26 27 View alignment SCOP MMDB CATH Chain 1 = 0.000239 26 27 View alignment 1ji0 ( Chain: A) Crystal structure analysis of the abc transporter from thermotoga maritima PDB_Info PDB_Structure Thermotoga maritima 0.000289 27 31 View alignment SCOP MMDB CATH 2ixe ( Chain: A, D) Crystal structure of the atpase domain of tap1 with atp (d645n mutant) PDB_Info PDB_Structure Rattus norvegicus Chain A = 0.000349 24 34 View alignment SCOP MMDB CATH Chain D = 0.000349 24 34 View alignment 2d2f ( Chain: A) Crystal structure of atypical cytoplasmic abc-atpase sufc from thermus thermophilus hb8 PDB_Info PDB_Structure Thermus thermophilus HB8 0.000510 31 26 View alignment SCOP MMDB CATH 2d2e ( Chain: A) Crystal structure of atypical cytoplasmic abc-atpase sufc from thermus thermophilus hb8 PDB_Info PDB_Structure Thermus thermophilus HB8 0.000510 31 26 View alignment SCOP MMDB CATH 2ihy ( Chain: A, B) Structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter PDB_Info PDB_Structure Staphylococcus aureus Chain A = 0.000840 25 33 View alignment SCOP MMDB CATH Chain B = 0.000840 25 33 View alignment 1r0w ( Chain: A, B, D, C) Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) apo PDB_Info PDB_Structure Mus musculus Chain A = 0.000870 23 36 View alignment SCOP MMDB CATH Chain B = 0.000870 23 36 View alignment Chain D = 0.000870 23 36 View alignment Chain C = 0.000870 23 36 View alignment 1q3h ( Chain: C, D, A, B) Mouse cftr nbd1 with amp.pnp PDB_Info PDB_Structure Mus musculus Chain C = 0.000870 23 36 View alignment SCOP MMDB CATH Chain D = 0.000870 23 36 View alignment Chain A = 0.000870 23 36 View alignment Chain B = 0.000870 23 36 View alignment 1r10 ( Chain: B, A) Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp, i4122 space group PDB_Info PDB_Structure Mus musculus Chain B = 0.000870 23 36 View alignment SCOP MMDB CATH Chain A = 0.000870 23 36 View alignment 1r0z ( Chain: B, A, C, D) Phosphorylated cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp PDB_Info PDB_Structure Mus musculus Chain B = 0.000870 23 36 View alignment SCOP MMDB CATH Chain A = 0.000870 23 36 View alignment Chain C = 0.000870 23 36 View alignment Chain D = 0.000870 23 36 View alignment 1r0y ( Chain: A, B, D, C) Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with adp PDB_Info PDB_Structure Mus musculus Chain A = 0.000870 23 36 View alignment SCOP MMDB CATH Chain B = 0.000870 23 36 View alignment Chain D = 0.000870 23 36 View alignment Chain C = 0.000870 23 36 View alignment 1r0x ( Chain: B, A, D, C) Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) with atp PDB_Info PDB_Structure Mus musculus Chain B = 0.000870 23 36 View alignment SCOP MMDB CATH Chain A = 0.000870 23 36 View alignment Chain D = 0.000870 23 36 View alignment Chain C = 0.000870 23 36 View alignment 2bbo ( Chain: A) Human nbd1 with phe508 PDB_Info PDB_Structure Homo sapiens 0.001799 23 35 View alignment SCOP MMDB CATH 2pzf ( Chain: A, B) Minimal human cftr first nucleotide binding domain as a head-to-tail dimer with delta f508 PDB_Info PDB_Structure Homo sapiens Chain A = 0.001999 24 33 View alignment SCOP MMDB CATH Chain B = 0.001999 24 33 View alignment 3d31 ( Chain: B, A) Modbc from methanosarcina acetivorans PDB_Info PDB_Structure Methanosarcina acetivorans Chain B = 0.001999 26 32 View alignment SCOP MMDB CATH Chain A = 0.001999 26 32 View alignment 2pcj ( Chain: A, B) Crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 PDB_Info PDB_Structure Aquifex aeolicus VF5 Chain A = 0.002299 25 31 View alignment SCOP MMDB CATH Chain B = 0.002299 25 31 View alignment 2pcl ( Chain: A) Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5 PDB_Info PDB_Structure Aquifex aeolicus VF5 0.002299 25 31 View alignment SCOP MMDB CATH 1xf9 ( Chain: D, A, C, B) Structure of nbd1 from murine cftr- f508s mutant PDB_Info PDB_Structure Mus musculus Chain D = 0.002400 25 33 View alignment SCOP MMDB CATH Chain A = 0.002400 25 33 View alignment Chain C = 0.002400 25 33 View alignment Chain B = 0.002400 25 33 View alignment 1xmi ( Chain: C, B, E, A, D) Crystal structure of human f508a nbd1 domain with atp PDB_Info PDB_Structure Homo sapiens Chain C = 0.002501 24 33 View alignment SCOP MMDB CATH Chain B = 0.002501 24 33 View alignment Chain E = 0.002501 24 33 View alignment Chain A = 0.002501 24 33 View alignment Chain D = 0.002501 24 33 View alignment 2bbt ( Chain: A, B) Human deltaf508 nbd1 with two solublizing mutations. PDB_Info PDB_Structure Homo sapiens Chain A = 0.002900 24 34 View alignment SCOP MMDB CATH Chain B = 0.002900 24 34 View alignment 2bbs ( Chain: B, A) Human deltaf508 nbd1 with three solubilizing mutations PDB_Info PDB_Structure Homo sapiens Chain B = 0.002900 24 34 View alignment SCOP MMDB CATH Chain A = 0.002900 24 34 View alignment 2cbz ( Chain: A) Structure of the human multidrug resistance protein 1 nucleotide binding domain 1 PDB_Info PDB_Structure Homo sapiens 0.003000 22 34 View alignment SCOP MMDB CATH 1xfa ( Chain: B, A) Structure of nbd1 from murine cftr- f508r mutant PDB_Info PDB_Structure Mus musculus Chain B = 0.003899 25 33 View alignment SCOP MMDB CATH Chain A = 0.003899 25 33 View alignment 3bk7 ( Chain: A) Structure of the complete abce1/rnaase-l inhibitor protein from pyrococcus abysii PDB_Info PDB_Structure Pyrococcus abyssi 0.005401 26 32 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
PDR15	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YDR406W	SGD Systematic Sequence
852015	NCBI: Gene ID
NP_010694.1	NCBI: RefSeq protein version ID
NP_010694.1	NCBI: RefSeq protein version ID
6320614	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
43 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hazelwood LA, et al. (2010) Involvement of Vacuolar Sequestration and Active Transport in Tolerance of Saccharomyces cerevisiae to Hop Iso-{alpha}-Acids. Appl Environ Microbiol 76(1):318-28	|AFT1 |OCH1 |PDR1 |PDR3 |PDR5 |RNR4 |SNQ2 |TPD3 |TPO1 |VPH2 |YRM1 |YRR1 |ZAP1
Genetic Interactions Strains/Constructs	Balgi AD and Roberge M (2009) Screening for chemical inhibitors of heterologous proteins expressed in yeast using a simple growth-restoration assay. Methods Mol Biol 486:125-37	|PDR1 |PDR10 |PDR11 |PDR3 |PDR5 |SNQ2 |YCF1 |YOR1
Mutants/Phenotypes Strains/Constructs	Jain C, et al. (2009) A pathogenesis assay using Saccharomyces cerevisiae and Caenorhabditis elegans reveals novel roles for yeast AP-1, Yap1, and host dual oxidase BLI-3 in fungal pathogenesis. Eukaryot Cell 8(8):1218-27	|CAD1 |PDR1 |SOD1 |YAP1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Knorre DA, et al. (2009) Amiodarone inhibits multiple drug resistance in yeast Saccharomyces cerevisiae. Arch Microbiol 191(8):675-9	|PDR10 |PDR11 |PDR3 |PDR5 |SNQ2 |YCF1 |YOR1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Rockwell NC, et al. (2009) ABC transporter Pdr10 regulates the membrane microenvironment of Pdr12 in Saccharomyces cerevisiae. J Membr Biol 229(1):27-52	|CHS3 |CHS6 |DNF1 |DNF2 |GAS1 |IPT1 |LEM3 |PDR10 |PDR12 |PDR18 |PDR5 |STE7 |SUR1 |YOL075C
Evolution Fungal Related Genes/Proteins	Seret ML, et al. (2009) Combined phylogeny and neighborhood analysis of the evolution of the ABC transporters conferring multiple drug resistance in hemiascomycete yeasts. BMC Genomics 10:459	|AUS1 |PDR10 |PDR11 |PDR12 |PDR18 |PDR5 |SNQ2 |YOL075C
RNA Levels and Processing	Woo DK, et al. (2009) Multiple pathways of mitochondrial-nuclear communication in yeast: Intergenomic signaling involves ABF1 and affects a different set of genes than retrograde regulation. Biochim Biophys Acta 1789(2):135-45	|ABF1 |ACH1 |AGX1 |ALD3 |ARG4 |ARG7 |ARO4 |ATO2 |ATO3 |ATP14 |ATP16 |ATP17 |ATP19 |ATP2 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Abolmaali S, et al. (2008) Engineered bakers yeast as a sensitive bioassay indicator organism for the trichothecene toxin deoxynivalenol. J Microbiol Methods 72(3):306-12	|AYT1 |PDR10 |PDR5 |UBI4 |UBP6
Regulation of	Banerjee D, et al. (2008) Responses of pathogenic and nonpathogenic yeast species to steroids reveal the functioning and evolution of multidrug resistance transcriptional networks. Eukaryot Cell 7(1):68-77	|BDH2 |GRE2 |ICT1 |PDR1 |PDR10 |PDR16 |PDR3 |PDR5 |RSB1 |SNQ2 |TPO1 |YGR035C |YLL056C |YLR346C |MORE
Genetic Interactions Mutants/Phenotypes Regulation of Strains/Constructs Transcription	Gulshan K, et al. (2008) Evidence for the bifunctional nature of mitochondrial phosphatidylserine decarboxylase: role in Pdr3-dependent retrograde regulation of PDR5 expression. Mol Cell Biol 28(19):5851-64	|LGE1 |PDR1 |PDR3 |PDR5 |PSD1 |PSD2
Translational Regulation	Melamed D, et al. (2008) Yeast translational response to high salinity: global analysis reveals regulation at multiple levels. RNA 14(7):1337-51	|ADK1 |AIM17 |ALD3 |AQR1 |ARG2 |ARG3 |ARG5,6 |ARG7 |ARG80 |ARG81 |ARG82 |AST1 |BCY1 |BTN2 |MORE
Regulation of Transcription	Ro DK, et al. (2008) Induction of multiple pleiotropic drug resistance genes in yeast engineered to produce an increased level of anti-malarial drug precursor, artemisinic acid. BMC Biotechnol 883	|PDR1 |PDR12 |PDR3 |PDR5 |SNQ2 |YOR1
RNA Levels and Processing	Trott A, et al. (2008) Activation of Heat Shock and Antioxidant Responses by the Natural Product Celastrol: Transcriptional Signatures of a Thiol-targeted Molecule. Mol Biol Cell 19(3):1104-12	|AAD14 |AAD15 |AAD16 |AAD3 |AAD4 |AAD6 |ADH5 |ADH6 |AHP1 |ALD3 |ALD4 |ALD6 |ARI1 |ATR1 |MORE
Regulation of	Wu WS and Li WH (2008) Identifying gene regulatory modules of heat shock response in yeast. BMC Genomics 9:439	|ADD37 |AFR1 |AGX1 |AHA1 |AIM17 |ALD4 |ALG13 |ARA1 |ASI1 |ATG12 |ATG8 |BAG7 |BDH1 |CAD1 |MORE
Cross-species Expression Fungal Related Genes/Proteins Infection and Antifungals Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Lamping E, et al. (2007) Characterization of three classes of membrane proteins involved in fungal azole resistance by functional hyperexpression in Saccharomyces cerevisiae. Eukaryot Cell 6(7):1150-65	|PDR1 |PDR10 |PDR11 |PDR3 |PDR5 |SNQ2 |YCF1 |YOR1
Function/Process Genetic Interactions Mutants/Phenotypes Regulation of Strains/Constructs Transcription	Schuller C, et al. (2007) Membrane-active Compounds Activate the Transcription Factors Pdr1 and Pdr3 Connecting Pleiotropic Drug Resistance and Membrane Lipid Homeostasis in Saccharomyces cerevisiae. Mol Biol Cell 18(12):4932-44	|MSN2 |MSN4 |PDR1 |PDR3 |PDR5
Regulation of Transcription	Cowart LA, et al. (2006) Distinct roles for de novo versus hydrolytic pathways of sphingolipid biosynthesis in Saccharomyces cerevisiae. Biochem J 393(Pt 3):733-40	|BSC3 |HAP4 |HSP12 |ISC1 |ISF1 |LCB1 |MST28 |POT1 |YBL109W |YGP1 |ZPR1
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Reviews	Gbelska Y, et al. (2006) Evolution of gene families: the multidrug resistance transporter genes in five related yeast species. FEMS Yeast Res 6(3):345-55	|ADP1 |AQR1 |ATM1 |ATR1 |AUS1 |AZR1 |BPT1 |DTR1 |FLR1 |HOL1 |MDL1 |MDL2 |NFT1 |PDR10 |MORE
Transcription	Hazelwood LA, et al. (2006) A new physiological role for Pdr12p in Saccharomyces cerevisiae: export of aromatic and branched-chain organic acids produced in amino acid catabolism. FEMS Yeast Res 6(6):937-45	|ACT1 |ADP1 |ARB1 |ARO10 |ATM1 |ATR1 |AUS1 |BPT1 |ENB1 |MDL1 |MDL2 |NFT1 |PDR10 |PDR11 |MORE
Reviews	Jungwirth H and Kuchler K (2006) Yeast ABC transporters-- a tale of sex, stress, drugs and aging. FEBS Lett 580(4):1131-8	|ARR1 |ATM1 |AUS1 |BPT1 |ECM22 |MDL1 |MDL2 |MSN2 |NGG1 |PDR1 |PDR11 |PDR12 |PDR3 |PDR5 |MORE
Other Features Transcription	Matsui K, et al. (2006) Screening for candidate genes involved in tolerance to organic solvents in yeast. Appl Microbiol Biotechnol 71(1):75-9	|AQY2 |CIS3 |GRE2 |ICT1 |PDR10 |PHO84 |PIR1 |PRY3 |SNQ2 |TIP1 |WSC3 |YNL190W |YOR1
DNA/RNA Sequence Features Mapping	Dunn B, et al. (2005) Microarray karyotyping of commercial wine yeast strains reveals shared, as well as unique, genomic signatures. BMC Genomics 6(1):53	|ADH4 |ATR1 |AYT1 |BRR6 |CSE1 |CUP1-1 |CUP1-2 |ENB1 |HAP2 |HXK2 |HXT11 |HXT12 |HXT9 |KAP114 |MORE
Reviews	Ernst R, et al. (2005) Yeast ATP-binding cassette transporters: cellular cleaning pumps. Methods Enzymol 400:460-84	|AUS1 |BPT1 |NFT1 |PDR10 |PDR11 |PDR12 |PDR5 |SNQ2 |VMR1 |YBT1 |YCF1 |YOR1
Fungal Related Genes/Proteins	Wada S, et al. (2005) Phosphorylation of candida glabrata ATP-binding cassette transporter Cdr1p regulates drug efflux activity and ATPase stability. J Biol Chem 280(1):94-103	|ADP1 |AUS1 |GCN20 |PDR10 |PDR11 |PDR12 |PDR18 |PDR5 |SNQ2 |VMR1 |YBT1 |YCF1 |YOL075C
Cellular Location Techniques and Reagents	Zybailov B, et al. (2005) Correlation of relative abundance ratios derived from Peptide ion chromatograms and spectrum counting for quantitative proteomic analysis using stable isotope labeling. Anal Chem 77(19):6218-24	|ADP1 |ARG4 |CHO2 |COT1 |EMP70 |HMG1 |IST2 |ITR1 |LEU1 |PDR10 |SNQ2 |SYG1 |VNX1 |VTC3 |MORE
Cell Cycle Phase Involved RNA Levels and Processing	de Lichtenberg U, et al. (2005) New weakly expressed cell cycle-regulated genes in yeast. Yeast 22(15):1191-201	|ACE2 |ACM1 |ADD37 |AIM34 |ALY2 |CLB3 |CLB4 |COS9 |CSI2 |DIF1 |DSE3 |FKH1 |GAS3 |GRX6 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kihara A and Igarashi Y (2004) Cross talk between sphingolipids and glycerophospholipids in the establishment of plasma membrane asymmetry. Mol Biol Cell 15(11):4949-59	|DHH1 |DNF1 |DNF2 |LCB4 |LEM3 |PDR1 |PDR10 |PDR12 |PDR18 |PDR3 |PDR5 |RSB1 |SNQ2 |YOR1 |MORE
RNA Levels and Processing Regulation of	Sirisattha S, et al. (2004) Toxicity of anionic detergents determined by Saccharomyces cerevisiae microarray analysis. Water Res 38(1):61-70	|ATX1 |CMK2 |CRS5 |DIA1 |GPX1 |GRE2 |GRX1 |GRX2 |GRX6 |GTT2 |GYP8 |HSP12 |HSP26 |HYR1 |MORE
Cellular Location DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins Protein Processing/Modification/Regulation Regulation of	Wolfger H, et al. (2004) The yeast Pdr15p ATP-binding cassette (ABC) protein is a general stress response factor implicated in cellular detoxification. J Biol Chem 279(12):11593-9	|HOG1 |MSN2 |PBS2 |PDR1 |PDR3 |PDR5
Regulation of Transcription	Hikkel I, et al. (2003) A general strategy to uncover transcription factor properties identifies a new regulator of drug resistance in yeast. J Biol Chem 278(13):11427-32	|AZR1 |CTT1 |GTT2 |PDR8 |QDR2 |SNG1 |YJL216C |YLL056C |YOR1
Mutants/Phenotypes Strains/Constructs	Hill P, et al. (2003) Recapitulation in Saccharomyces cerevisiae of cytochrome b mutations conferring resistance to atovaquone in Pneumocystis jiroveci. Antimicrob Agents Chemother 47(9):2725-31	|COB |PDR1 |PDR10 |PDR11 |PDR3 |PDR5 |SNQ2 |YCF1 |YOR1
RNA Levels and Processing Regulation of	Hellauer K, et al. (2002) Zinc cluster protein Rdr1p is a transcriptional repressor of the PDR5 gene encoding a multidrug transporter. J Biol Chem 277(20):17671-6	|GAL4 |PDR1 |PDR16 |PDR3 |PDR5 |PHO84 |RDR1 |RSB1
DNA/RNA Sequence Features RNA Levels and Processing Regulation of Transcription	Devaux F, et al. (2001) An artificial transcription activator mimics the genome-wide properties of the yeast Pdr1 transcription factor. EMBO Rep 2(6):493-8	|BDH2 |FSP2 |GAL4 |GRE2 |HSP26 |HXK1 |HXT11 |HXT12 |HXT8 |HXT9 |ICT1 |INO1 |IPT1 |PDR1 |MORE
RNA Levels and Processing Regulation of	Epstein CB, et al. (2001) Genome-wide responses to mitochondrial dysfunction. Mol Biol Cell 12(2):297-308	|ACO1 |ACS1 |ADH2 |ADY2 |AGP1 |AGP2 |ALD4 |ALT1 |ATO3 |BAT2 |BIO2 |CAR1 |CDA1 |CIT1 |MORE
Evolution	Friedman R and Hughes AL (2001) Gene duplication and the structure of eukaryotic genomes. Genome Res 11(3):373-81	|AAD10 |AAD16 |AAD4 |ARF1 |ARF2 |ASK10 |ASN1 |ASN2 |CLA4 |CLB1 |CLB2 |CLB5 |CLB6 |COS1 |MORE
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Regulation of Strains/Constructs	Rogers B, et al. (2001) The pleitropic drug ABC transporters from Saccharomyces cerevisiae. J Mol Microbiol Biotechnol 3(2):207-14	|PDR1 |PDR10 |PDR11 |PDR3 |PDR5 |SNQ2 |YCF1 |YOR1
Reviews	Bauer BE, et al. (1999) Inventory and function of yeast ABC proteins: about sex, stress, pleiotropic drug and heavy metal resistance. Biochim Biophys Acta 1461(2):217-36	|ADP1 |ARB1 |ATM1 |AUS1 |BPT1 |CAF16 |GCN20 |HEF3 |MDL1 |MDL2 |NEW1 |NFT1 |PDR1 |PDR10 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Decottignies A, et al. (1998) ATPase and multidrug transport activities of the overexpressed yeast ABC protein Yor1p. J Biol Chem 273(20):12612-22	|PDR1 |PDR10 |PDR3 |PDR5 |SNQ2 |YOR1
RNA Levels and Processing Regulation of	Gray NS, et al. (1998) Exploiting chemical libraries, structure, and genomics in the search for kinase inhibitors. Science 281(5376):533-8	|ACH1 |ATR1 |BDH2 |CAK1 |CDC28 |CLB1 |CLB2 |CTS1 |CTT1 |CYC3 |DSE2 |EGT2 |FAR1 |GPG1 |MORE
Fungal Related Genes/Proteins Reviews	Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC proteins. Nat Genet 15(2):137-45	|ADP1 |ARB1 |ATM1 |AUS1 |BPT1 |CAF16 |GCN20 |HEF3 |MDL1 |MDL2 |NEW1 |NFT1 |PDR10 |PDR11 |MORE
DNA/RNA Sequence Features Function/Process RNA Levels and Processing Regulation of Transcription	Wolfger H, et al. (1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15 are novel targets for the Pdr1 and Pdr3 transcriptional regulators. FEBS Lett 418(3):269-74	|PDR1 |PDR10 |PDR3
Reviews	Andre B (1995) An overview of membrane transport proteins in Saccharomyces cerevisiae. Yeast 11(16):1575-611	|CCC2 |COT1 |CTR1 |DIP5 |ESBP6 |FEN2 |FUI1 |MEP1 |MEP2 |NHX1 |PCA1 |PDR10 |PHO84 |PHO87 |MORE

Return to SGD

Send a Message to the SGD Curators