---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

GPI8/YDR331W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIV: 1129584 to 1130819 CDS: 1129584 - 1130819 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
GPI8	YDR331W		ORF, Verified	S000002739
Description
ER membrane glycoprotein subunit of the glycosylphosphatidylinositol transamidase complex that adds glycosylphosphatidylinositol (GPI) anchors to newly synthesized proteins; human PIG-K protein is a functional homolog

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By GPI-anchor transamidase activity Fraering P, et al. (2001) The GPI transamidase complex of Saccharomyces cerevisiae contains Gaa1p, Gpi8p, and Gpi16p. Mol Biol Cell 12(10):3295-306        IPI : Inferred from Physical Interaction IMP : Inferred from Mutant Phenotype Assigned on 2002-07-24 SGD cysteine-type endopeptidase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001096 Assigned on 2007-05-23 UniProtKB cysteine-type peptidase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0788 Assigned on 2007-05-23 UniProtKB hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2007-05-23 UniProtKB peptidase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0645 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By GPI anchor biosynthetic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0337 Assigned on 2007-05-23 UniProtKB attachment of GPI anchor to protein Fraering P, et al. (2001) The GPI transamidase complex of Saccharomyces cerevisiae contains Gaa1p, Gpi8p, and Gpi16p. Mol Biol Cell 12(10):3295-306        IMP : Inferred from Mutant Phenotype Assigned on 2002-07-24 SGD lipoprotein metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT proteolysis DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001096 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By GPI-anchor transamidase complex Fraering P, et al. (2001) The GPI transamidase complex of Saccharomyces cerevisiae contains Gaa1p, Gpi8p, and Gpi16p. Mol Biol Cell 12(10):3295-306        IPI : Inferred from Physical Interaction Assigned on 2005-02-09 SGD endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9905 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forGPI8/YDR331W for GPI8 1) Benghezal M, et al. (1996) Yeast Gpi8p is essential for GPI anchor attachment onto proteins. EMBO J 15(23):6575-83      2) Fraering P, et al. (2001) The GPI transamidase complex of Saccharomyces cerevisiae contains Gaa1p, Gpi8p, and Gpi16p. Mol Biol Cell 12(10):3295-306        3) Benghezal M, et al. (1995) Identification of six complementation classes involved in the biosynthesis of glycosylphosphatidylinositol anchors in Saccharomyces cerevisiae. J Cell Biol 130(6):1333-44

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for GPI8/YDR331W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for GPI8/YDR331W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MRIAMHL C-term TYDLYTN Length(aa) 411 MW(Da) 47,402 pI 4.84 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.022   Codon Adaptation Index 0.129   Frequency of Optimal Codons 0.437   Hydropathicity of Protein -0.249   Aromaticity Score 0.119

10 20 30 40 50 | | | | | MRIAMHLPLLLLYIFLLPLSGANNTDAAHEVIATNTNNWAVLVSTSRFWF NYRHMANVLSMYRTVKRLGIPDSQIILMLSDDVACNSRNLFPGSVFNNKD HAIDLYGDSVEVDYRGYEVTVENFIRLLTDRWTEDHPKSKRLLTDENSNI FIYMTGHGGDDFLKFQDAEEIASEDIADAFQQMYEKKRYNEIFFMIDTCQ ANTMYSKFYSPNILAVGSSEMDESSYSHHSDVEIGVAVIDRFTYYCLDFL EQIDKNSTLTLQDLFDSFTFEKIHSHVGVRTDLFDRNPSEVLITDFFANV QNVIPDDSKPLSVSHYHHYKDHIDTAQYELNNNVLDLALETYRKNNQSSK IEKKIKDIKSTSVLDVDIDSNECFFTSFKQSATIILALIVTILWFMLRGN TAKATYDLYTN*

Protein Structures from PDB: proteins of known structure with sequence similarity to GPI8/YDR331W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
GPI8	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YDR331W	SGD Systematic Sequence
851931	NCBI: Gene ID
NP_010618.1	NCBI: RefSeq protein version ID
NP_010618.1	NCBI: RefSeq protein version ID
6320538	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
31 curated references; 0 references not yet curated
Reviews	Fujita M and Kinoshita T (2009) Structural remodeling of GPI anchors during biosynthesis and after attachment to proteins. FEBS Lett	|ARV1 |BST1 |CDC1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |MORE
Mutants/Phenotypes Strains/Constructs	Ungar L, et al. (2009) A genome-wide screen for essential yeast genes that affect telomere length maintenance. Nucleic Acids Res 37(12):3840-9	|AAR2 |ALA1 |APC4 |ARC15 |ARC35 |ARP2 |ARP3 |BBP1 |CBF5 |CDC13 |CDC16 |CDC19 |CDC34 |CDC36 |MORE
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Reviews	Bosson R and Conzelmann A (2007) Multiple functions of inositolphosphorylceramides in the formation and intracellular transport of glycosylphosphatidylinositol-anchored proteins in yeast. Biochem Soc Symp (74):199-209	|BST1 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Mutants/Phenotypes Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Meitzler JL, et al. (2007) Truncation of the caspase-related subunit (Gpi8p) of Saccharomyces cerevisiae GPI transamidase: Dimerization revealed. Arch Biochem Biophys 462(1):83-93
Reviews	Orlean P and Menon AK (2007) Thematic review series: lipid posttranslational modifications. GPI anchoring of protein in yeast and mammalian cells, or: how we learned to stop worrying and love glycophospholipids. J Lipid Res 48(5):993-1011	|BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |MORE
Reviews	Pittet M and Conzelmann A (2007) Biosynthesis and function of GPI proteins in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):405-20	|BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI11 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |MORE
Reviews	Zacks MA and Garg N (2006) Recent developments in the molecular, biochemical and functional characterization of GPI8 and the GPI-anchoring mechanism [review]. Mol Membr Biol 23(3):209-25
Cellular Location Mutants/Phenotypes Protein Processing/Modification/Regulation Protein-protein Interactions Strains/Constructs Techniques and Reagents	Zhu Y, et al. (2005) Gpi17p does not stably interact with other subunits of glycosylphosphatidylinositol transamidase in Saccharomyces cerevisiae. Biochim Biophys Acta 1735(1):79-88	|GAA1 |GPI16 |GPI17
Function/Process Genetic Interactions Mutants/Phenotypes	Grimme SJ, et al. (2004) Deficiencies in the endoplasmic reticulum (ER)-membrane protein Gab1p perturb transfer of glycosylphosphatidylinositol to proteins and cause perinuclear ER-associated actin bar formation. Mol Biol Cell 15(6):2758-70	|ACT1 |GAA1 |GAB1 |GPI16 |GPI17
Non-Fungal Related Genes/Proteins	Hong Y, et al. (2003) Human PIG-U and yeast Cdc91p are the fifth subunit of GPI transamidase that attaches GPI-anchors to proteins. Mol Biol Cell 14(5):1780-9	|GAA1 |GAB1
Non-Fungal Related Genes/Proteins	Lillico S, et al. (2003) Essential roles for GPI-anchored proteins in African trypanosomes revealed using mutants deficient in GPI8. Mol Biol Cell 14(3):1182-94
Non-Fungal Related Genes/Proteins	Nagamune K, et al. (2003) GPI transamidase of Trypanosoma brucei has two previously uncharacterized (trypanosomatid transamidase 1 and 2) and three common subunits. Proc Natl Acad Sci U S A 100(19):10682-7	|GAA1 |GPI16
Non-Fungal Related Genes/Proteins	Ohishi K, et al. (2003) Two subunits of glycosylphosphatidylinositol transamidase, GPI8 and PIG-T, form a functionally important intermolecular disulfide bridge. J Biol Chem 278(16):13959-67
Non-Fungal Related Genes/Proteins	Delorenzi M, et al. (2002) Genes for glycosylphosphatidylinositol toxin biosynthesis in Plasmodium falciparum. Infect Immun 70(8):4510-22	|DPM1 |GAA1 |GPI1 |GPI10 |GPI12 |GPI13 |GPI14 |SPT14
Non-Fungal Related Genes/Proteins	Kang X, et al. (2002) GPI anchor transamidase of Trypanosoma brucei: in vitro assay of the recombinant protein and VSG anchor exchange. J Cell Sci 115(Pt 12):2529-39
Cross-species Expression Non-Fungal Related Genes/Proteins	Meyer U, et al. (2002) The glycosylphosphatidylinositol (GPI) signal sequence of human placental alkaline phosphatase is not recognized by human Gpi8p in the context of the yeast GPI anchoring machinery. Mol Microbiol 46(3):745-8
Reviews	Eisenhaber B, et al. (2001) Post-translational GPI lipid anchor modification of proteins in kingdoms of life: analysis of protein sequence data from complete genomes. Protein Eng 14(1):17-25
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Fraering P, et al. (2001) The GPI transamidase complex of Saccharomyces cerevisiae contains Gaa1p, Gpi8p, and Gpi16p. Mol Biol Cell 12(10):3295-306	|GAA1 |GPI16 |SEC61
Function/Process Non-Fungal Related Genes/Proteins	Ohishi K, et al. (2001) PIG-S and PIG-T, essential for GPI anchor attachment to proteins, form a complex with GAA1 and GPI8. EMBO J 20(15):4088-98	|GAA1 |GPI16 |GPI17
Fungal Related Genes/Proteins	Shams-Eldin H, et al. (2001) The Schizosaccharomyces pombe GPI8 gene complements a Saccharomyces cerevisiae GPI8 anchoring mutant. Yeast 18(1):33-9
Non-Fungal Related Genes/Proteins	Spurway TD, et al. (2001) Early events in glycosylphosphatidylinositol anchor addition. substrate proteins associate with the transamidase subunit gpi8p. J Biol Chem 276(19):15975-82
Non-Fungal Related Genes/Proteins	Vidugiriene J, et al. (2001) Endoplasmic reticulum proteins involved in glycosylphosphatidylinositol-anchor attachment: photocrosslinking studies in a cell-free system. Eur J Biochem 268(8):2290-300	|GAA1
Non-Fungal Related Genes/Proteins	Hilley JD, et al. (2000) Leishmania mexicana mutants lacking glycosylphosphatidylinositol (GPI):protein transamidase provide insights into the biosynthesis and functions of GPI-anchored proteins. Mol Biol Cell 11(4):1183-95
Function/Process Reviews	Kinoshita T and Inoue N (2000) Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis. Curr Opin Chem Biol 4(6):632-8	|DPM1 |GAA1 |GPI1 |GPI10 |GPI13 |GPI14 |GPI19 |GPI2 |LAS21 |MCD4 |SMP3 |SPT14
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Meyer U, et al. (2000) Active site determination of Gpi8p, a caspase-related enzyme required for glycosylphosphatidylinositol anchor addition to proteins. Biochemistry 39(12):3461-71	|GAA1 |GAS1
Non-Fungal Related Genes/Proteins Strains/Constructs	Ohishi K, et al. (2000) Gaa1p and gpi8p are components of a glycosylphosphatidylinositol (GPI) transamidase that mediates attachment of GPI to proteins. Mol Biol Cell 11(5):1523-33	|GAA1
Non-Fungal Related Genes/Proteins	Sharma DK, et al. (2000) Soluble GPI8 restores glycosylphosphatidylinositol anchoring in a trypanosome cell-free system depleted of lumenal endoplasmic reticulum proteins. Biochem J 351 Pt 3():717-22
Cross-species Expression Non-Fungal Related Genes/Proteins	De Sampaio G, et al. (1999) A constitutive role for GPI anchors in Saccharomyces cerevisiae: cell wall targeting. Mol Microbiol 34(2):247-56	|GAS1 |TIR1 |YPS1
Cellular Location Cross-species Expression DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Benghezal M, et al. (1996) Yeast Gpi8p is essential for GPI anchor attachment onto proteins. EMBO J 15(23):6575-83
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Regulatory Role Strains/Constructs	Benghezal M, et al. (1995) Identification of six complementation classes involved in the biosynthesis of glycosylphosphatidylinositol anchors in Saccharomyces cerevisiae. J Cell Biol 130(6):1333-44	|GAA1 |GAS1 |GPI4 |GPI5 |GPI6 |GPI9 |LAS21 |SAG1

Return to SGD

Send a Message to the SGD Curators