---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

GPI11/YDR302W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrIV: 1067728 to 1068387 CDS: 1067728 - 1068387 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
GPI11	YDR302W		ORF, Verified	S000002710
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 2000-06-05. Gene name expires on 2001-06-05.
Description
ER membrane protein involved in a late step of glycosylphosphatidylinositol (GPI) anchor assembly; involved in the addition of phosphoethanolamine to the multiply mannosylated GPI intermediate; human PIG-Fp is a functional homolog

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By contributes_to mannose-ethanolamine phosphotransferase activity Taron CH, et al. (2000) Glycosylphosphatidylinositol biosynthesis defects in Gpi11p- and Gpi13p-deficient yeast suggest a branched pathway and implicate gpi13p in phosphoethanolamine transfer to the third mannose. Mol Biol Cell 11(5):1611-30        IMP : Inferred from Mutant Phenotype Assigned on 2006-10-12 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By GPI anchor biosynthetic process Taron CH, et al. (2000) Glycosylphosphatidylinositol biosynthesis defects in Gpi11p- and Gpi13p-deficient yeast suggest a branched pathway and implicate gpi13p in phosphoethanolamine transfer to the third mannose. Mol Biol Cell 11(5):1611-30        IMP : Inferred from Mutant Phenotype Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR009580 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0337 Assigned on 2007-05-23 UniProtKB peptidyl-amino acid modification Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Taron CH, et al. (2000) Glycosylphosphatidylinositol biosynthesis defects in Gpi11p- and Gpi13p-deficient yeast suggest a branched pathway and implicate gpi13p in phosphoethanolamine transfer to the third mannose. Mol Biol Cell 11(5):1611-30        ISS : Inferred from Sequence or structural Similarity Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB endoplasmic reticulum membrane Taron CH, et al. (2000) Glycosylphosphatidylinositol biosynthesis defects in Gpi11p- and Gpi13p-deficient yeast suggest a branched pathway and implicate gpi13p in phosphoethanolamine transfer to the third mannose. Mol Biol Cell 11(5):1611-30        IC : Inferred By Curator from GPI anchor biosynthetic process Assigned on 2005-04-16 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR009580 Assigned on 2009-06-17 UniProtKB integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR009580 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forGPI11/YDR302W for GPI11 1) Taron CH, et al. (2000) Glycosylphosphatidylinositol biosynthesis defects in Gpi11p- and Gpi13p-deficient yeast suggest a branched pathway and implicate gpi13p in phosphoethanolamine transfer to the third mannose. Mol Biol Cell 11(5):1611-30

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for GPI11/YDR302W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for GPI11/YDR302W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MPAKKRT C-term YTIGAYI Length(aa) 219 MW(Da) 25,262 pI 10.19 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.020   Codon Adaptation Index 0.147   Frequency of Optimal Codons 0.423   Hydropathicity of Protein 0.435   Aromaticity Score 0.164	10 20 30 40 50 | | | | | MPAKKRTRKTVKKTVSFSDDTTLTTHQNREKKNVDHDRPPVYVRKTPLMT FPYHLVALLYYYVFVSSNFNTVKLLSFLIPTQVAYLVLQFNKCTVYGNKI IKINYSLTIICLGVTFLLSFPTMLLTILFGAPLMDLLWETWLLSLHFAFL AYPAVYSVFNCDFKVGLWKKYFIFIVVGGWISCVVIPLDWDRDWQNWPIP IVVGGYLGALVGYTIGAYI*

Protein Structures from PDB: proteins of known structure with sequence similarity to GPI11/YDR302W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
GPI11	2001-10-05	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YDR302W	SGD Systematic Sequence
851896	NCBI: Gene ID
NP_010588.1	NCBI: RefSeq protein version ID
NP_010588.1	NCBI: RefSeq protein version ID
6320508	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
9 curated references; 0 references not yet curated
Reviews	Fujita M and Kinoshita T (2009) Structural remodeling of GPI anchors during biosynthesis and after attachment to proteins. FEBS Lett	|ARV1 |BST1 |CDC1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |MORE
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
Reviews	Bosson R and Conzelmann A (2007) Multiple functions of inositolphosphorylceramides in the formation and intracellular transport of glycosylphosphatidylinositol-anchored proteins in yeast. Biochem Soc Symp (74):199-209	|BST1 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |GPI19 |MORE
Reviews	Orlean P and Menon AK (2007) Thematic review series: lipid posttranslational modifications. GPI anchoring of protein in yeast and mammalian cells, or: how we learned to stop worrying and love glycophospholipids. J Lipid Res 48(5):993-1011	|BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Reviews	Pittet M and Conzelmann A (2007) Biosynthesis and function of GPI proteins in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1771(3):405-20	|BST1 |CWH43 |ERI1 |GAA1 |GAB1 |GPI1 |GPI10 |GPI12 |GPI13 |GPI14 |GPI15 |GPI16 |GPI17 |GPI18 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Wiedman JM, et al. (2007) In vivo characterization of the GPI assembly defect in yeast mcd4-174 mutants and bypass of the Mcd4p-dependent step in mcd4Delta cells. FEMS Yeast Res 7(1):78-83	|GPI10 |MCD4
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52	|ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Grimme SJ, et al. (2001) The essential Smp3 protein is required for addition of the side-branching fourth mannose during assembly of yeast glycosylphosphatidylinositols. J Biol Chem 276(29):27731-9	|ALG12 |ALG9 |GAA1 |GPI1 |GPI10 |GPI13 |SMP3
Cross-species Expression Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs Substrates/Ligands/Cofactors	Taron CH, et al. (2000) Glycosylphosphatidylinositol biosynthesis defects in Gpi11p- and Gpi13p-deficient yeast suggest a branched pathway and implicate gpi13p in phosphoethanolamine transfer to the third mannose. Mol Biol Cell 11(5):1611-30	|GPI13 |LAS21

Return to SGD

Send a Message to the SGD Curators